Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3NQ97

Protein Details
Accession A0A5C3NQ97    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MAKSKNHTNHNQNKKAHRNGIKKPKSTHydrophilic
NLS Segment(s)
PositionSequence
14-35KKAHRNGIKKPKSTRTRSLKGV
Subcellular Location(s) nucl 21, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNKKAHRNGIKKPKSTRTRSLKGVDAKFRRNALYALIGSHKARAEQKAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.82
4 0.81
5 0.79
6 0.8
7 0.84
8 0.83
9 0.8
10 0.79
11 0.79
12 0.79
13 0.77
14 0.76
15 0.74
16 0.72
17 0.7
18 0.66
19 0.62
20 0.61
21 0.59
22 0.58
23 0.54
24 0.53
25 0.51
26 0.5
27 0.45
28 0.39
29 0.34
30 0.27
31 0.27
32 0.22
33 0.2
34 0.21
35 0.23
36 0.21
37 0.24
38 0.22
39 0.22
40 0.26