Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3NCA3

Protein Details
Accession A0A5C3NCA3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
25-57YFDYRRRNDASFRKQLRKEKKKIDKHVSQTKADHydrophilic
NLS Segment(s)
PositionSequence
37-47RKQLRKEKKKI
Subcellular Location(s) mito 7cyto 7cyto_mito 7, extr 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002056  MAS20  
IPR001214  SET_dom  
IPR046341  SET_dom_sf  
IPR023392  Tom20_dom_sf  
Gene Ontology GO:0005742  C:mitochondrial outer membrane translocase complex  
GO:0006605  P:protein targeting  
Pfam View protein in Pfam  
PF02064  MAS20  
PF00856  SET  
PROSITE View protein in PROSITE  
PS50280  SET  
CDD cd20071  SET_SMYD  
Amino Acid Sequences MTRTSTVFTVAGVTLISGLLVYAVYFDYRRRNDASFRKQLRKEKKKIDKHVSQTKADASVSIDPDELRAALEKVRSEDMPASSAEREQFFMSQVGMGEQLCTQGPVFHLPAALCFYRALRVYPSPVELIVIYQKTVPEPVFKIVMDLMNMDVSEPSSSSGSANQAGNSEEEEEPSPVSPVRSSPPSETSSHEWDRVTDPGSQTTELHSGRCVGYYNTFPPKSMNVKVDQAEAADGKKKILVAAKDIKAGDVIYKEQPIVTVLDLDLEGTGRYCTQCFRQIEEDTAVFAEDDRLSAVYCSKDCQARSKSQSENILFGIEPLLPPEIAPDLTNLDERKAAQQAFVDYLKRRGKAVPLLVSRFLARQVASETMKMVPGVAGSTPVSSNSIEDGEYSLMDHIERLRYLVTNVPEEEVTLVSGVLKTALPGIEAFVSQDRQTVLSGKMAYNAIGVCFGNGRNDKPDTGERPEDRERTRTPFGTSKQIGSGFYAVSAYINHSCDPSARPSFSDGTAELSLIANRDIKEGEEITMAYVDVSQHPDESPVDARRRRRIELARGWRFACTCTKCLAEGAQGGAADTDVPDQKDESKVEEVVQRVEGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.07
4 0.04
5 0.04
6 0.04
7 0.04
8 0.03
9 0.04
10 0.05
11 0.06
12 0.08
13 0.12
14 0.21
15 0.25
16 0.3
17 0.33
18 0.37
19 0.46
20 0.56
21 0.63
22 0.64
23 0.7
24 0.75
25 0.8
26 0.86
27 0.88
28 0.88
29 0.88
30 0.88
31 0.9
32 0.91
33 0.93
34 0.93
35 0.91
36 0.9
37 0.91
38 0.86
39 0.79
40 0.72
41 0.64
42 0.57
43 0.47
44 0.38
45 0.31
46 0.3
47 0.29
48 0.26
49 0.23
50 0.19
51 0.2
52 0.2
53 0.16
54 0.11
55 0.11
56 0.11
57 0.13
58 0.16
59 0.17
60 0.19
61 0.23
62 0.22
63 0.23
64 0.26
65 0.25
66 0.24
67 0.22
68 0.22
69 0.2
70 0.23
71 0.22
72 0.19
73 0.19
74 0.19
75 0.19
76 0.18
77 0.18
78 0.16
79 0.14
80 0.13
81 0.12
82 0.11
83 0.1
84 0.09
85 0.09
86 0.1
87 0.09
88 0.09
89 0.09
90 0.09
91 0.1
92 0.14
93 0.15
94 0.14
95 0.16
96 0.15
97 0.16
98 0.19
99 0.18
100 0.15
101 0.14
102 0.14
103 0.17
104 0.18
105 0.18
106 0.19
107 0.21
108 0.25
109 0.26
110 0.27
111 0.24
112 0.23
113 0.22
114 0.17
115 0.16
116 0.17
117 0.16
118 0.14
119 0.14
120 0.15
121 0.14
122 0.17
123 0.17
124 0.16
125 0.17
126 0.19
127 0.21
128 0.2
129 0.21
130 0.19
131 0.19
132 0.15
133 0.14
134 0.12
135 0.1
136 0.1
137 0.09
138 0.07
139 0.07
140 0.07
141 0.06
142 0.07
143 0.07
144 0.08
145 0.08
146 0.1
147 0.12
148 0.15
149 0.15
150 0.15
151 0.15
152 0.16
153 0.16
154 0.14
155 0.15
156 0.12
157 0.13
158 0.13
159 0.13
160 0.13
161 0.12
162 0.13
163 0.1
164 0.11
165 0.1
166 0.11
167 0.14
168 0.18
169 0.2
170 0.23
171 0.27
172 0.29
173 0.31
174 0.33
175 0.33
176 0.37
177 0.37
178 0.36
179 0.31
180 0.3
181 0.3
182 0.28
183 0.25
184 0.2
185 0.19
186 0.2
187 0.22
188 0.21
189 0.19
190 0.2
191 0.24
192 0.22
193 0.21
194 0.17
195 0.18
196 0.17
197 0.17
198 0.16
199 0.11
200 0.13
201 0.15
202 0.2
203 0.26
204 0.26
205 0.25
206 0.26
207 0.3
208 0.33
209 0.35
210 0.33
211 0.28
212 0.32
213 0.33
214 0.32
215 0.27
216 0.22
217 0.18
218 0.16
219 0.14
220 0.14
221 0.13
222 0.12
223 0.13
224 0.13
225 0.14
226 0.17
227 0.17
228 0.19
229 0.27
230 0.28
231 0.31
232 0.3
233 0.28
234 0.24
235 0.23
236 0.18
237 0.12
238 0.13
239 0.11
240 0.12
241 0.11
242 0.11
243 0.11
244 0.1
245 0.1
246 0.08
247 0.07
248 0.06
249 0.06
250 0.06
251 0.06
252 0.05
253 0.04
254 0.04
255 0.04
256 0.04
257 0.04
258 0.05
259 0.05
260 0.07
261 0.1
262 0.17
263 0.18
264 0.22
265 0.26
266 0.27
267 0.29
268 0.29
269 0.26
270 0.19
271 0.18
272 0.14
273 0.09
274 0.08
275 0.07
276 0.05
277 0.05
278 0.05
279 0.05
280 0.05
281 0.05
282 0.07
283 0.07
284 0.07
285 0.08
286 0.1
287 0.14
288 0.14
289 0.22
290 0.25
291 0.32
292 0.37
293 0.41
294 0.42
295 0.42
296 0.49
297 0.42
298 0.39
299 0.32
300 0.27
301 0.21
302 0.19
303 0.16
304 0.08
305 0.07
306 0.06
307 0.06
308 0.05
309 0.05
310 0.06
311 0.06
312 0.06
313 0.06
314 0.06
315 0.07
316 0.08
317 0.11
318 0.1
319 0.1
320 0.11
321 0.11
322 0.13
323 0.15
324 0.15
325 0.14
326 0.14
327 0.15
328 0.17
329 0.17
330 0.18
331 0.15
332 0.24
333 0.27
334 0.27
335 0.27
336 0.26
337 0.29
338 0.32
339 0.36
340 0.35
341 0.35
342 0.37
343 0.36
344 0.35
345 0.31
346 0.26
347 0.22
348 0.15
349 0.12
350 0.1
351 0.11
352 0.15
353 0.15
354 0.15
355 0.15
356 0.14
357 0.15
358 0.13
359 0.11
360 0.07
361 0.06
362 0.07
363 0.05
364 0.06
365 0.06
366 0.07
367 0.07
368 0.07
369 0.09
370 0.08
371 0.09
372 0.08
373 0.09
374 0.08
375 0.08
376 0.09
377 0.08
378 0.08
379 0.08
380 0.07
381 0.06
382 0.06
383 0.07
384 0.07
385 0.08
386 0.08
387 0.09
388 0.09
389 0.1
390 0.11
391 0.15
392 0.16
393 0.17
394 0.18
395 0.18
396 0.17
397 0.16
398 0.16
399 0.11
400 0.09
401 0.07
402 0.06
403 0.05
404 0.05
405 0.05
406 0.05
407 0.05
408 0.05
409 0.06
410 0.06
411 0.06
412 0.06
413 0.07
414 0.07
415 0.07
416 0.08
417 0.09
418 0.1
419 0.1
420 0.12
421 0.11
422 0.12
423 0.13
424 0.15
425 0.14
426 0.16
427 0.18
428 0.17
429 0.19
430 0.18
431 0.18
432 0.16
433 0.15
434 0.11
435 0.11
436 0.11
437 0.08
438 0.09
439 0.09
440 0.15
441 0.17
442 0.19
443 0.22
444 0.24
445 0.25
446 0.28
447 0.35
448 0.34
449 0.38
450 0.45
451 0.42
452 0.47
453 0.54
454 0.56
455 0.52
456 0.53
457 0.51
458 0.5
459 0.54
460 0.49
461 0.48
462 0.49
463 0.49
464 0.52
465 0.5
466 0.45
467 0.43
468 0.42
469 0.37
470 0.32
471 0.3
472 0.19
473 0.18
474 0.16
475 0.11
476 0.1
477 0.1
478 0.11
479 0.13
480 0.14
481 0.15
482 0.15
483 0.16
484 0.17
485 0.2
486 0.24
487 0.26
488 0.26
489 0.27
490 0.31
491 0.33
492 0.32
493 0.32
494 0.24
495 0.24
496 0.23
497 0.21
498 0.18
499 0.16
500 0.15
501 0.13
502 0.15
503 0.13
504 0.13
505 0.15
506 0.14
507 0.15
508 0.18
509 0.18
510 0.17
511 0.15
512 0.15
513 0.14
514 0.14
515 0.13
516 0.09
517 0.09
518 0.09
519 0.1
520 0.14
521 0.13
522 0.14
523 0.14
524 0.17
525 0.17
526 0.19
527 0.23
528 0.27
529 0.36
530 0.42
531 0.5
532 0.57
533 0.63
534 0.64
535 0.68
536 0.7
537 0.71
538 0.75
539 0.78
540 0.77
541 0.76
542 0.72
543 0.66
544 0.57
545 0.5
546 0.49
547 0.43
548 0.37
549 0.36
550 0.38
551 0.35
552 0.36
553 0.36
554 0.3
555 0.27
556 0.26
557 0.24
558 0.21
559 0.21
560 0.18
561 0.15
562 0.11
563 0.09
564 0.11
565 0.12
566 0.13
567 0.14
568 0.16
569 0.19
570 0.25
571 0.25
572 0.27
573 0.27
574 0.28
575 0.3
576 0.34
577 0.33
578 0.3