Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3MS53

Protein Details
Accession A0A5C3MS53    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
83-110QWYGTHIKKDKKTKERRRPTVKFREINKBasic
NLS Segment(s)
PositionSequence
90-103KKDKKTKERRRPTV
Subcellular Location(s) mito 7cyto 7cyto_mito 7, golg 5
Family & Domain DBs
Amino Acid Sequences MGIDYSIRQLRAQLLVFWRNQYPFDQPLDGQDTLTWWEGLQHHPSADILAMLAIRIFSILVNSMADERTGSCMTLTDMIMIGQWYGTHIKKDKKTKERRRPTVKFREINKDILRSIQGLKPDSDEQVPDNVTDDSNDKGDDEGDRAGGTTADNSGVVDSADSEEVPVSVILVEDEIDLDSVFLRDLVSPEPASSPTAATEKQKVPEVLPAAKPGVVDWDW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.35
3 0.36
4 0.38
5 0.38
6 0.35
7 0.35
8 0.33
9 0.32
10 0.3
11 0.32
12 0.32
13 0.27
14 0.31
15 0.35
16 0.33
17 0.27
18 0.23
19 0.2
20 0.2
21 0.21
22 0.16
23 0.1
24 0.14
25 0.15
26 0.19
27 0.22
28 0.2
29 0.19
30 0.2
31 0.2
32 0.16
33 0.15
34 0.11
35 0.07
36 0.06
37 0.05
38 0.05
39 0.05
40 0.04
41 0.03
42 0.04
43 0.04
44 0.03
45 0.04
46 0.05
47 0.06
48 0.06
49 0.06
50 0.07
51 0.07
52 0.07
53 0.07
54 0.07
55 0.1
56 0.1
57 0.1
58 0.09
59 0.1
60 0.1
61 0.12
62 0.12
63 0.08
64 0.08
65 0.08
66 0.08
67 0.07
68 0.06
69 0.04
70 0.04
71 0.05
72 0.08
73 0.09
74 0.13
75 0.18
76 0.25
77 0.33
78 0.43
79 0.52
80 0.59
81 0.7
82 0.78
83 0.83
84 0.87
85 0.91
86 0.92
87 0.9
88 0.9
89 0.9
90 0.88
91 0.83
92 0.77
93 0.76
94 0.68
95 0.66
96 0.58
97 0.49
98 0.4
99 0.34
100 0.31
101 0.22
102 0.22
103 0.16
104 0.17
105 0.16
106 0.16
107 0.18
108 0.18
109 0.18
110 0.16
111 0.15
112 0.13
113 0.14
114 0.14
115 0.11
116 0.12
117 0.11
118 0.1
119 0.1
120 0.1
121 0.09
122 0.09
123 0.09
124 0.08
125 0.08
126 0.08
127 0.08
128 0.09
129 0.08
130 0.07
131 0.07
132 0.07
133 0.07
134 0.07
135 0.06
136 0.05
137 0.05
138 0.06
139 0.06
140 0.05
141 0.05
142 0.05
143 0.05
144 0.05
145 0.05
146 0.05
147 0.06
148 0.05
149 0.06
150 0.06
151 0.06
152 0.06
153 0.05
154 0.04
155 0.04
156 0.04
157 0.04
158 0.04
159 0.05
160 0.04
161 0.04
162 0.04
163 0.05
164 0.04
165 0.05
166 0.05
167 0.05
168 0.05
169 0.04
170 0.05
171 0.06
172 0.07
173 0.09
174 0.12
175 0.12
176 0.13
177 0.15
178 0.15
179 0.16
180 0.15
181 0.15
182 0.14
183 0.17
184 0.19
185 0.22
186 0.28
187 0.31
188 0.34
189 0.4
190 0.39
191 0.37
192 0.41
193 0.43
194 0.41
195 0.39
196 0.39
197 0.34
198 0.33
199 0.32
200 0.25