Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3MSZ0

Protein Details
Accession A0A5C3MSZ0   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
179-201AVASPSRKVVQKKKKPVDDDELEHydrophilic
NLS Segment(s)
PositionSequence
144-164RKEERLLRKEEKKEVKRAAKR
Subcellular Location(s) nucl 16, cyto_nucl 14, cyto 10
Family & Domain DBs
Amino Acid Sequences MDSFANIKKDLDRGLLRVTDPETTRVFTYSPGVLRDFWRFDKALRNSSFALPVITPGGYDQFATLFNAEPPRYKMATYDFTARVVISPGPRFPLAELLDHLADPETPSTSTKGEYSERKRKIINGMLWDTAESKQRFLEKQEQRKEERLLRKEEKKEVKRAAKRAYVAAMEVDVDPKDAVASPSRKVVQKKKKPVDDDELEGFTSDEAEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.31
4 0.31
5 0.31
6 0.29
7 0.28
8 0.29
9 0.26
10 0.26
11 0.26
12 0.24
13 0.23
14 0.19
15 0.2
16 0.2
17 0.21
18 0.21
19 0.22
20 0.22
21 0.25
22 0.29
23 0.3
24 0.29
25 0.31
26 0.29
27 0.29
28 0.38
29 0.4
30 0.44
31 0.41
32 0.43
33 0.4
34 0.41
35 0.42
36 0.32
37 0.28
38 0.19
39 0.17
40 0.15
41 0.12
42 0.11
43 0.09
44 0.1
45 0.09
46 0.09
47 0.08
48 0.07
49 0.08
50 0.09
51 0.09
52 0.08
53 0.09
54 0.14
55 0.14
56 0.16
57 0.18
58 0.22
59 0.22
60 0.21
61 0.21
62 0.22
63 0.26
64 0.26
65 0.28
66 0.25
67 0.25
68 0.25
69 0.23
70 0.18
71 0.15
72 0.15
73 0.12
74 0.13
75 0.13
76 0.15
77 0.15
78 0.15
79 0.14
80 0.18
81 0.16
82 0.15
83 0.16
84 0.15
85 0.15
86 0.14
87 0.14
88 0.08
89 0.07
90 0.06
91 0.06
92 0.05
93 0.05
94 0.06
95 0.08
96 0.08
97 0.09
98 0.1
99 0.12
100 0.15
101 0.23
102 0.31
103 0.4
104 0.43
105 0.45
106 0.45
107 0.46
108 0.5
109 0.49
110 0.44
111 0.4
112 0.39
113 0.37
114 0.36
115 0.33
116 0.27
117 0.21
118 0.24
119 0.19
120 0.17
121 0.18
122 0.22
123 0.23
124 0.27
125 0.36
126 0.38
127 0.48
128 0.56
129 0.6
130 0.61
131 0.66
132 0.67
133 0.65
134 0.66
135 0.61
136 0.62
137 0.64
138 0.69
139 0.69
140 0.73
141 0.75
142 0.72
143 0.75
144 0.76
145 0.77
146 0.77
147 0.79
148 0.77
149 0.73
150 0.68
151 0.62
152 0.55
153 0.45
154 0.38
155 0.3
156 0.22
157 0.16
158 0.14
159 0.13
160 0.09
161 0.09
162 0.08
163 0.08
164 0.08
165 0.08
166 0.1
167 0.16
168 0.19
169 0.19
170 0.26
171 0.3
172 0.36
173 0.44
174 0.53
175 0.57
176 0.65
177 0.75
178 0.79
179 0.84
180 0.85
181 0.84
182 0.83
183 0.77
184 0.72
185 0.65
186 0.57
187 0.47
188 0.41
189 0.33
190 0.23