Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3NCW7

Protein Details
Accession A0A5C3NCW7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
37-63DRTPGGGRRRDPPRRMRRDEKSEEFERBasic
NLS Segment(s)
PositionSequence
41-54GGGRRRDPPRRMRR
Subcellular Location(s) plas 7, mito 6, cyto 6, cyto_mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR005552  Scramblase  
Gene Ontology GO:0017128  F:phospholipid scramblase activity  
Pfam View protein in Pfam  
PF03803  Scramblase  
Amino Acid Sequences MLTLRGCRTLPVLAGSRFAPRLALPATRSYALSRFGDRTPGGGRRRDPPRRMRRDEKSEEFERLSSDPFGRTEESRADDERQQLSWGERERMQAMDPEESLRVILSNPSLVITRQIEMLNIFVGFEQANRYVISNELGETLGFIAEEPRGFFSTFSRQIFKTHRPFRALVMDPQGAPILWIRRPFAWINSRMFVQRLNNYSEYTTEGEPVLDTFGEVQQRWHPWRRRYDVFRRETSRPILSTISDSQPEPTQSTSSSEPDESEETFTQLAAIDEGLWAWSFSLRDYQGEEFASIRRAFRGLGREVFTDTGQYFIRFHPDLSDSEIAARGEKPIIERNLSMDERALILATAVTIDFDYFSRHSGLVMSVKRQIVFLFVTACCVMVYNRNRVGEVIIIVES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.31
4 0.29
5 0.28
6 0.24
7 0.17
8 0.22
9 0.23
10 0.26
11 0.24
12 0.29
13 0.32
14 0.32
15 0.33
16 0.31
17 0.31
18 0.31
19 0.32
20 0.3
21 0.3
22 0.3
23 0.35
24 0.32
25 0.32
26 0.33
27 0.39
28 0.41
29 0.44
30 0.46
31 0.49
32 0.6
33 0.66
34 0.7
35 0.72
36 0.78
37 0.82
38 0.88
39 0.89
40 0.89
41 0.89
42 0.89
43 0.86
44 0.83
45 0.76
46 0.71
47 0.63
48 0.53
49 0.46
50 0.37
51 0.31
52 0.26
53 0.24
54 0.21
55 0.2
56 0.23
57 0.22
58 0.22
59 0.23
60 0.25
61 0.27
62 0.28
63 0.3
64 0.31
65 0.33
66 0.37
67 0.36
68 0.32
69 0.29
70 0.28
71 0.27
72 0.29
73 0.29
74 0.27
75 0.27
76 0.3
77 0.3
78 0.29
79 0.28
80 0.26
81 0.24
82 0.23
83 0.21
84 0.19
85 0.18
86 0.17
87 0.16
88 0.12
89 0.1
90 0.07
91 0.09
92 0.08
93 0.08
94 0.08
95 0.09
96 0.09
97 0.09
98 0.13
99 0.13
100 0.13
101 0.15
102 0.15
103 0.15
104 0.14
105 0.15
106 0.11
107 0.09
108 0.08
109 0.06
110 0.07
111 0.06
112 0.06
113 0.08
114 0.08
115 0.09
116 0.09
117 0.1
118 0.1
119 0.11
120 0.12
121 0.1
122 0.09
123 0.09
124 0.09
125 0.08
126 0.08
127 0.07
128 0.05
129 0.05
130 0.04
131 0.04
132 0.05
133 0.06
134 0.06
135 0.08
136 0.09
137 0.1
138 0.1
139 0.12
140 0.2
141 0.25
142 0.26
143 0.27
144 0.26
145 0.32
146 0.37
147 0.43
148 0.46
149 0.48
150 0.51
151 0.53
152 0.53
153 0.51
154 0.53
155 0.46
156 0.39
157 0.36
158 0.32
159 0.28
160 0.28
161 0.25
162 0.16
163 0.14
164 0.13
165 0.1
166 0.11
167 0.13
168 0.14
169 0.14
170 0.18
171 0.18
172 0.22
173 0.26
174 0.28
175 0.29
176 0.29
177 0.3
178 0.27
179 0.27
180 0.24
181 0.21
182 0.21
183 0.21
184 0.24
185 0.24
186 0.24
187 0.24
188 0.22
189 0.21
190 0.18
191 0.15
192 0.12
193 0.11
194 0.1
195 0.1
196 0.09
197 0.07
198 0.05
199 0.04
200 0.04
201 0.06
202 0.08
203 0.08
204 0.1
205 0.13
206 0.18
207 0.22
208 0.31
209 0.37
210 0.42
211 0.52
212 0.57
213 0.62
214 0.67
215 0.73
216 0.74
217 0.72
218 0.72
219 0.69
220 0.65
221 0.61
222 0.57
223 0.49
224 0.4
225 0.36
226 0.3
227 0.25
228 0.25
229 0.24
230 0.22
231 0.19
232 0.19
233 0.18
234 0.19
235 0.19
236 0.17
237 0.15
238 0.14
239 0.14
240 0.17
241 0.18
242 0.17
243 0.18
244 0.17
245 0.17
246 0.18
247 0.19
248 0.16
249 0.18
250 0.16
251 0.15
252 0.15
253 0.14
254 0.12
255 0.1
256 0.1
257 0.06
258 0.06
259 0.05
260 0.04
261 0.05
262 0.05
263 0.04
264 0.04
265 0.04
266 0.05
267 0.05
268 0.06
269 0.11
270 0.12
271 0.13
272 0.16
273 0.17
274 0.18
275 0.18
276 0.18
277 0.15
278 0.15
279 0.19
280 0.17
281 0.16
282 0.15
283 0.15
284 0.15
285 0.19
286 0.24
287 0.24
288 0.28
289 0.29
290 0.29
291 0.31
292 0.31
293 0.27
294 0.23
295 0.19
296 0.16
297 0.15
298 0.15
299 0.14
300 0.14
301 0.2
302 0.18
303 0.18
304 0.19
305 0.21
306 0.21
307 0.26
308 0.27
309 0.2
310 0.21
311 0.24
312 0.2
313 0.19
314 0.18
315 0.14
316 0.13
317 0.14
318 0.16
319 0.22
320 0.25
321 0.27
322 0.27
323 0.28
324 0.35
325 0.34
326 0.31
327 0.25
328 0.22
329 0.19
330 0.19
331 0.16
332 0.08
333 0.08
334 0.07
335 0.06
336 0.06
337 0.04
338 0.05
339 0.05
340 0.05
341 0.06
342 0.06
343 0.11
344 0.11
345 0.13
346 0.15
347 0.14
348 0.15
349 0.15
350 0.19
351 0.22
352 0.25
353 0.27
354 0.31
355 0.33
356 0.33
357 0.33
358 0.29
359 0.25
360 0.23
361 0.21
362 0.19
363 0.17
364 0.2
365 0.19
366 0.2
367 0.16
368 0.15
369 0.15
370 0.2
371 0.26
372 0.31
373 0.38
374 0.39
375 0.4
376 0.39
377 0.4
378 0.34
379 0.29