Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3N617

Protein Details
Accession A0A5C3N617    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
61-82WSIFDAKKKKKAFKTLCKAHLIHydrophilic
NLS Segment(s)
PositionSequence
67-71KKKKK
Subcellular Location(s) mito 16, cyto 5.5, cyto_nucl 5.5, nucl 4.5
Family & Domain DBs
Amino Acid Sequences MPFPIPTNTWSNPRLQILQHQPSTPQRGHVENQAISETAGPFELHGFLELCFPGTDRAGLWSIFDAKKKKKAFKTLCKAHLILGRLLRTPHRPHESAEARR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.34
3 0.4
4 0.43
5 0.5
6 0.48
7 0.44
8 0.45
9 0.48
10 0.53
11 0.44
12 0.4
13 0.35
14 0.36
15 0.38
16 0.4
17 0.39
18 0.34
19 0.34
20 0.29
21 0.26
22 0.22
23 0.21
24 0.14
25 0.08
26 0.08
27 0.07
28 0.06
29 0.06
30 0.07
31 0.06
32 0.06
33 0.06
34 0.06
35 0.07
36 0.07
37 0.07
38 0.06
39 0.07
40 0.07
41 0.07
42 0.07
43 0.06
44 0.08
45 0.08
46 0.09
47 0.08
48 0.08
49 0.13
50 0.14
51 0.19
52 0.24
53 0.28
54 0.37
55 0.44
56 0.52
57 0.56
58 0.65
59 0.71
60 0.75
61 0.81
62 0.82
63 0.82
64 0.78
65 0.7
66 0.64
67 0.58
68 0.49
69 0.43
70 0.38
71 0.34
72 0.31
73 0.32
74 0.32
75 0.36
76 0.4
77 0.45
78 0.48
79 0.47
80 0.48
81 0.57