Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3R154

Protein Details
Accession A0A5C3R154    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
51-76VTRGAGFRKEKNKKKRGSYRGGEITVHydrophilic
NLS Segment(s)
PositionSequence
57-68FRKEKNKKKRGS
Subcellular Location(s) nucl 18, cyto 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF05022  SRP40_C  
Amino Acid Sequences KPQRKVNTPFRRVDPDKVMEAVNAQLQDNRYDKKIAPTNDYGARAHQDLIVTRGAGFRKEKNKKKRGSYRGGEITVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.59
3 0.54
4 0.48
5 0.43
6 0.32
7 0.29
8 0.23
9 0.17
10 0.14
11 0.12
12 0.12
13 0.13
14 0.17
15 0.18
16 0.19
17 0.18
18 0.2
19 0.2
20 0.26
21 0.31
22 0.29
23 0.31
24 0.32
25 0.34
26 0.35
27 0.36
28 0.29
29 0.24
30 0.23
31 0.19
32 0.17
33 0.15
34 0.12
35 0.11
36 0.13
37 0.12
38 0.11
39 0.1
40 0.13
41 0.13
42 0.16
43 0.18
44 0.24
45 0.34
46 0.45
47 0.55
48 0.63
49 0.72
50 0.77
51 0.85
52 0.89
53 0.88
54 0.88
55 0.85
56 0.84
57 0.83