Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3R4P8

Protein Details
Accession A0A5C3R4P8   
Localization Confidence Medium
Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
33-60SSPESKPKSTPSKPKPKRGPKHAIPTSSHydrophilic
NLS Segment(s)
PositionSequence
36-55ESKPKSTPSKPKPKRGPKHA
Subcellular Location(s) nucl 19, mito 5.5, cyto_mito 4.5
Family & Domain DBs
Amino Acid Sequences MPATKRKAPNSTASDGASSRTTRSKQAKTDGASSPESKPKSTPSKPKPKRGPKHAIPTSSFKAKAMPLHVNITHTPPPIVDENEVSVAAADPGFIGASTLVVSEFSTGSYGWKGSKRVTIELPGAEGEEKEKVQVMITINATVVGSKNQEEGEKNGDADAEAKKDAAEETAEEDEDKDDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.39
3 0.36
4 0.3
5 0.24
6 0.23
7 0.27
8 0.28
9 0.34
10 0.43
11 0.49
12 0.52
13 0.59
14 0.63
15 0.6
16 0.64
17 0.59
18 0.54
19 0.5
20 0.46
21 0.42
22 0.42
23 0.4
24 0.36
25 0.33
26 0.37
27 0.43
28 0.49
29 0.56
30 0.59
31 0.68
32 0.76
33 0.85
34 0.88
35 0.89
36 0.9
37 0.9
38 0.9
39 0.87
40 0.89
41 0.84
42 0.79
43 0.71
44 0.68
45 0.61
46 0.56
47 0.48
48 0.37
49 0.34
50 0.3
51 0.3
52 0.28
53 0.28
54 0.24
55 0.28
56 0.28
57 0.28
58 0.27
59 0.29
60 0.27
61 0.23
62 0.2
63 0.16
64 0.18
65 0.17
66 0.18
67 0.14
68 0.11
69 0.12
70 0.12
71 0.12
72 0.1
73 0.07
74 0.06
75 0.05
76 0.04
77 0.03
78 0.02
79 0.03
80 0.03
81 0.02
82 0.03
83 0.02
84 0.03
85 0.03
86 0.03
87 0.03
88 0.03
89 0.03
90 0.04
91 0.04
92 0.04
93 0.05
94 0.05
95 0.06
96 0.06
97 0.07
98 0.09
99 0.12
100 0.14
101 0.16
102 0.21
103 0.23
104 0.25
105 0.26
106 0.28
107 0.27
108 0.25
109 0.24
110 0.19
111 0.17
112 0.14
113 0.12
114 0.1
115 0.09
116 0.09
117 0.08
118 0.1
119 0.09
120 0.09
121 0.13
122 0.14
123 0.16
124 0.16
125 0.16
126 0.15
127 0.15
128 0.15
129 0.12
130 0.11
131 0.09
132 0.1
133 0.1
134 0.12
135 0.13
136 0.16
137 0.17
138 0.2
139 0.23
140 0.22
141 0.22
142 0.2
143 0.19
144 0.17
145 0.17
146 0.17
147 0.14
148 0.13
149 0.13
150 0.13
151 0.13
152 0.14
153 0.12
154 0.11
155 0.1
156 0.14
157 0.16
158 0.16
159 0.16
160 0.16