Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3Q7B6

Protein Details
Accession A0A5C3Q7B6    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
108-134KVVRYCGAKCQKKDWKKHKGVCFETNYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9, cyto 8, mito 5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002893  Znf_MYND  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF01753  zf-MYND  
PROSITE View protein in PROSITE  
PS01360  ZF_MYND_1  
PS50865  ZF_MYND_2  
Amino Acid Sequences MAMLQWCDVTPGNDAVACIPSATRQAPAVKTKNLMENERFKELPRYYQVEISRLEGMLGAGEMFAKSAPYPGYYYDDMRKYSRARLGMGIDNCPVCMEEGEMVCSKCKVVRYCGAKCQKKDWKKHKGVCFETNY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.14
4 0.12
5 0.1
6 0.09
7 0.09
8 0.13
9 0.13
10 0.13
11 0.15
12 0.2
13 0.25
14 0.33
15 0.37
16 0.36
17 0.39
18 0.4
19 0.44
20 0.44
21 0.44
22 0.41
23 0.45
24 0.46
25 0.47
26 0.45
27 0.39
28 0.44
29 0.4
30 0.4
31 0.36
32 0.37
33 0.34
34 0.39
35 0.39
36 0.34
37 0.33
38 0.29
39 0.25
40 0.2
41 0.18
42 0.12
43 0.11
44 0.07
45 0.06
46 0.04
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.04
55 0.05
56 0.06
57 0.07
58 0.08
59 0.13
60 0.14
61 0.16
62 0.2
63 0.22
64 0.23
65 0.24
66 0.27
67 0.25
68 0.29
69 0.31
70 0.29
71 0.27
72 0.28
73 0.3
74 0.32
75 0.32
76 0.28
77 0.25
78 0.23
79 0.21
80 0.18
81 0.15
82 0.1
83 0.08
84 0.08
85 0.08
86 0.09
87 0.11
88 0.13
89 0.13
90 0.14
91 0.14
92 0.13
93 0.14
94 0.2
95 0.21
96 0.25
97 0.34
98 0.41
99 0.47
100 0.56
101 0.64
102 0.66
103 0.66
104 0.7
105 0.73
106 0.74
107 0.8
108 0.81
109 0.81
110 0.84
111 0.9
112 0.89
113 0.88
114 0.87