Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3QGU2

Protein Details
Accession A0A5C3QGU2    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-30ATMACIHRCKPQPKRLPNRLVCRPPRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, nucl 10, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MRAAATMACIHRCKPQPKRLPNRLVCRPPRAPKTTSNKQPGSCALTKESPANFRPDILIRRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.6
3 0.66
4 0.75
5 0.84
6 0.86
7 0.89
8 0.88
9 0.87
10 0.86
11 0.85
12 0.79
13 0.76
14 0.74
15 0.71
16 0.7
17 0.66
18 0.59
19 0.58
20 0.62
21 0.64
22 0.65
23 0.66
24 0.63
25 0.59
26 0.59
27 0.54
28 0.52
29 0.45
30 0.38
31 0.33
32 0.31
33 0.32
34 0.34
35 0.33
36 0.32
37 0.31
38 0.35
39 0.32
40 0.3
41 0.32
42 0.34