Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3QSL5

Protein Details
Accession A0A5C3QSL5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
90-109LEPSVRKHDKKTRQHLPLVPHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 11, mito 10, plas 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR044851  Wax_synthase  
IPR032805  Wax_synthase_dom  
Gene Ontology GO:0016020  C:membrane  
GO:0008374  F:O-acyltransferase activity  
GO:0006629  P:lipid metabolic process  
Pfam View protein in Pfam  
PF13813  MBOAT_2  
Amino Acid Sequences LFLAYLSRRRNTYRLRLLLLPAVIGSLVSWPYQHTWVSTPELRDLLVQDWGISLMVVAFIAKSLHLALDPNGTLKVGEDSEAQLPASGLLEPSVRKHDKKTRQHLPLVPDAVYDACEVAISQRGIGYKFGAGTYIPPHTKPLERKPFLRATFLSLLRNLFILDALDTALRIIPGLLQGEGDSTLFNAALPPLPRYALSTSITLLTVWHMFTGFTVGYDMSALFCVGALGSSPSSWPPVLQNPVKSDSLHKFWARSWHQWLRQAFYVYGGYSGKWLAGTPGMVVGMFAASALVHECSVNMTGLPWEWYPVGFFMMQPVFLGMEKLYTKITGKRVGGWKGGVWAYGCLALTSQAYVDSWYRRGLRGGLALAVPPQFSLIGHLVQWYSGSIKDCCSCT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.67
3 0.66
4 0.64
5 0.6
6 0.5
7 0.4
8 0.29
9 0.23
10 0.17
11 0.13
12 0.1
13 0.07
14 0.08
15 0.08
16 0.08
17 0.1
18 0.13
19 0.16
20 0.17
21 0.17
22 0.19
23 0.23
24 0.3
25 0.32
26 0.31
27 0.32
28 0.31
29 0.3
30 0.28
31 0.26
32 0.21
33 0.2
34 0.18
35 0.14
36 0.14
37 0.14
38 0.12
39 0.1
40 0.08
41 0.04
42 0.04
43 0.04
44 0.04
45 0.03
46 0.04
47 0.04
48 0.04
49 0.05
50 0.05
51 0.06
52 0.06
53 0.08
54 0.09
55 0.13
56 0.13
57 0.14
58 0.14
59 0.13
60 0.13
61 0.12
62 0.14
63 0.1
64 0.11
65 0.11
66 0.13
67 0.14
68 0.15
69 0.14
70 0.12
71 0.11
72 0.1
73 0.1
74 0.08
75 0.06
76 0.06
77 0.08
78 0.09
79 0.11
80 0.2
81 0.24
82 0.26
83 0.35
84 0.45
85 0.54
86 0.64
87 0.72
88 0.73
89 0.76
90 0.82
91 0.78
92 0.73
93 0.7
94 0.62
95 0.51
96 0.41
97 0.34
98 0.26
99 0.21
100 0.16
101 0.09
102 0.06
103 0.06
104 0.06
105 0.06
106 0.1
107 0.09
108 0.09
109 0.11
110 0.12
111 0.13
112 0.14
113 0.14
114 0.1
115 0.11
116 0.11
117 0.1
118 0.09
119 0.09
120 0.11
121 0.16
122 0.16
123 0.16
124 0.19
125 0.21
126 0.27
127 0.33
128 0.41
129 0.46
130 0.49
131 0.51
132 0.55
133 0.61
134 0.56
135 0.54
136 0.44
137 0.39
138 0.42
139 0.41
140 0.36
141 0.29
142 0.27
143 0.22
144 0.22
145 0.16
146 0.1
147 0.08
148 0.06
149 0.05
150 0.05
151 0.05
152 0.05
153 0.04
154 0.04
155 0.04
156 0.04
157 0.04
158 0.03
159 0.03
160 0.05
161 0.05
162 0.05
163 0.05
164 0.05
165 0.06
166 0.06
167 0.06
168 0.04
169 0.04
170 0.04
171 0.04
172 0.04
173 0.04
174 0.04
175 0.06
176 0.07
177 0.08
178 0.08
179 0.08
180 0.09
181 0.11
182 0.12
183 0.13
184 0.14
185 0.14
186 0.14
187 0.14
188 0.14
189 0.11
190 0.1
191 0.08
192 0.07
193 0.06
194 0.06
195 0.05
196 0.05
197 0.05
198 0.07
199 0.06
200 0.05
201 0.06
202 0.05
203 0.05
204 0.06
205 0.06
206 0.04
207 0.04
208 0.04
209 0.03
210 0.03
211 0.03
212 0.03
213 0.03
214 0.03
215 0.04
216 0.04
217 0.04
218 0.05
219 0.05
220 0.07
221 0.07
222 0.08
223 0.09
224 0.14
225 0.21
226 0.23
227 0.27
228 0.28
229 0.32
230 0.33
231 0.31
232 0.31
233 0.29
234 0.3
235 0.32
236 0.3
237 0.28
238 0.29
239 0.38
240 0.38
241 0.39
242 0.44
243 0.48
244 0.51
245 0.57
246 0.57
247 0.51
248 0.5
249 0.47
250 0.37
251 0.31
252 0.27
253 0.2
254 0.21
255 0.16
256 0.12
257 0.11
258 0.11
259 0.09
260 0.08
261 0.08
262 0.06
263 0.07
264 0.07
265 0.07
266 0.07
267 0.07
268 0.07
269 0.06
270 0.05
271 0.04
272 0.04
273 0.03
274 0.03
275 0.02
276 0.03
277 0.04
278 0.04
279 0.05
280 0.05
281 0.05
282 0.06
283 0.08
284 0.08
285 0.07
286 0.07
287 0.07
288 0.08
289 0.11
290 0.09
291 0.1
292 0.1
293 0.1
294 0.11
295 0.11
296 0.12
297 0.1
298 0.09
299 0.13
300 0.13
301 0.13
302 0.12
303 0.12
304 0.11
305 0.11
306 0.12
307 0.07
308 0.11
309 0.11
310 0.12
311 0.12
312 0.13
313 0.16
314 0.21
315 0.28
316 0.31
317 0.32
318 0.39
319 0.46
320 0.49
321 0.49
322 0.45
323 0.4
324 0.37
325 0.37
326 0.31
327 0.24
328 0.2
329 0.17
330 0.17
331 0.16
332 0.11
333 0.11
334 0.11
335 0.1
336 0.1
337 0.09
338 0.08
339 0.08
340 0.1
341 0.14
342 0.16
343 0.18
344 0.23
345 0.26
346 0.27
347 0.29
348 0.29
349 0.3
350 0.31
351 0.3
352 0.27
353 0.25
354 0.24
355 0.23
356 0.22
357 0.17
358 0.13
359 0.12
360 0.1
361 0.1
362 0.14
363 0.14
364 0.14
365 0.15
366 0.17
367 0.16
368 0.16
369 0.16
370 0.13
371 0.12
372 0.14
373 0.17
374 0.17
375 0.21