Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3QDT7

Protein Details
Accession A0A5C3QDT7   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
7-33GDKDTAKAGTPRKKRDRAKPTTTTTTKHydrophilic
NLS Segment(s)
PositionSequence
16-25TPRKKRDRAK
Subcellular Location(s) nucl 9mito 9mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01389  HMG-box_ROX1-like  
Amino Acid Sequences MSFKTTGDKDTAKAGTPRKKRDRAKPTTTTTTKNGTGRKDPSYIPRAPNAFILFRSSFIRSQRVPGDVEGRNASLSKIVGLCWNALPPTERAHWEEKATLAQAEHRRRYPDWRFRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.45
3 0.53
4 0.62
5 0.66
6 0.75
7 0.8
8 0.85
9 0.87
10 0.87
11 0.87
12 0.85
13 0.82
14 0.82
15 0.77
16 0.71
17 0.63
18 0.59
19 0.55
20 0.51
21 0.48
22 0.43
23 0.46
24 0.46
25 0.45
26 0.42
27 0.39
28 0.41
29 0.43
30 0.42
31 0.37
32 0.38
33 0.36
34 0.34
35 0.35
36 0.3
37 0.24
38 0.2
39 0.22
40 0.18
41 0.17
42 0.19
43 0.18
44 0.19
45 0.2
46 0.24
47 0.2
48 0.23
49 0.24
50 0.24
51 0.23
52 0.21
53 0.25
54 0.22
55 0.23
56 0.21
57 0.19
58 0.17
59 0.17
60 0.15
61 0.11
62 0.1
63 0.09
64 0.08
65 0.08
66 0.1
67 0.11
68 0.12
69 0.11
70 0.12
71 0.11
72 0.12
73 0.13
74 0.12
75 0.16
76 0.17
77 0.2
78 0.22
79 0.27
80 0.29
81 0.3
82 0.3
83 0.27
84 0.27
85 0.26
86 0.23
87 0.18
88 0.24
89 0.31
90 0.39
91 0.44
92 0.46
93 0.5
94 0.51
95 0.61
96 0.64