Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7TRM8

Protein Details
Accession A7TRM8    Localization Confidence High Confidence Score 19.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-24AKLVHNVQKKQHRERSQLTSRARHydrophilic
39-58QDYHKKEKSLKILREKVKERBasic
190-209ESLKRKKLKNLKIMQSHIKRHydrophilic
NLS Segment(s)
PositionSequence
229-253NGSKKKITDPKTGKISFKWKKQRKR
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR007144  SSU_processome_Utp11  
Gene Ontology GO:0005730  C:nucleolus  
GO:0032040  C:small-subunit processome  
GO:0006364  P:rRNA processing  
KEGG vpo:Kpol_431p7  -  
Pfam View protein in Pfam  
PF03998  Utp11  
Amino Acid Sequences MAKLVHNVQKKQHRERSQLTSRARLGHLEKHKDYVKRAQDYHKKEKSLKILREKVKERNEDEYYHGMHSRKLDQKNNLLYVDRNNNEDLSNDQVKLLKSQDVNYIRTLRTAELNKIENYRKKNLIINSTSLNKESDNHKVFVDNKNELKNFKPEVYFNTSKELLHKRENRLTNDQLLETEFSSFDSTVNESLKRKKLKNLKIMQSHIKRESELKNIEQRMNLQREVMKNGSKKKITDPKTGKISFKWKKQRKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.82
3 0.83
4 0.83
5 0.83
6 0.78
7 0.76
8 0.7
9 0.65
10 0.58
11 0.54
12 0.49
13 0.49
14 0.53
15 0.54
16 0.52
17 0.54
18 0.59
19 0.57
20 0.58
21 0.58
22 0.58
23 0.57
24 0.6
25 0.64
26 0.67
27 0.72
28 0.78
29 0.75
30 0.72
31 0.7
32 0.73
33 0.73
34 0.73
35 0.73
36 0.72
37 0.75
38 0.76
39 0.8
40 0.79
41 0.78
42 0.77
43 0.76
44 0.69
45 0.68
46 0.63
47 0.56
48 0.54
49 0.48
50 0.41
51 0.35
52 0.35
53 0.27
54 0.27
55 0.27
56 0.31
57 0.35
58 0.41
59 0.46
60 0.48
61 0.56
62 0.59
63 0.6
64 0.53
65 0.46
66 0.4
67 0.39
68 0.41
69 0.34
70 0.3
71 0.27
72 0.26
73 0.25
74 0.24
75 0.2
76 0.18
77 0.18
78 0.16
79 0.16
80 0.18
81 0.18
82 0.2
83 0.19
84 0.17
85 0.16
86 0.18
87 0.26
88 0.27
89 0.28
90 0.29
91 0.31
92 0.27
93 0.27
94 0.27
95 0.19
96 0.21
97 0.21
98 0.21
99 0.22
100 0.24
101 0.24
102 0.27
103 0.32
104 0.32
105 0.35
106 0.37
107 0.36
108 0.35
109 0.39
110 0.38
111 0.39
112 0.36
113 0.33
114 0.31
115 0.31
116 0.29
117 0.25
118 0.22
119 0.16
120 0.16
121 0.17
122 0.24
123 0.23
124 0.24
125 0.23
126 0.25
127 0.28
128 0.32
129 0.35
130 0.3
131 0.31
132 0.35
133 0.36
134 0.35
135 0.34
136 0.34
137 0.31
138 0.28
139 0.27
140 0.23
141 0.27
142 0.35
143 0.35
144 0.3
145 0.33
146 0.31
147 0.29
148 0.35
149 0.36
150 0.32
151 0.38
152 0.44
153 0.46
154 0.54
155 0.6
156 0.6
157 0.6
158 0.59
159 0.55
160 0.5
161 0.43
162 0.35
163 0.3
164 0.25
165 0.18
166 0.15
167 0.1
168 0.09
169 0.11
170 0.1
171 0.09
172 0.09
173 0.11
174 0.12
175 0.15
176 0.17
177 0.19
178 0.27
179 0.35
180 0.41
181 0.43
182 0.5
183 0.59
184 0.65
185 0.72
186 0.75
187 0.76
188 0.77
189 0.79
190 0.8
191 0.78
192 0.76
193 0.71
194 0.63
195 0.55
196 0.53
197 0.52
198 0.5
199 0.47
200 0.46
201 0.49
202 0.52
203 0.53
204 0.48
205 0.5
206 0.5
207 0.51
208 0.45
209 0.4
210 0.4
211 0.41
212 0.46
213 0.44
214 0.42
215 0.44
216 0.52
217 0.58
218 0.57
219 0.56
220 0.6
221 0.66
222 0.65
223 0.69
224 0.68
225 0.67
226 0.73
227 0.76
228 0.69
229 0.67
230 0.72
231 0.7
232 0.73
233 0.75