Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3Q8V1

Protein Details
Accession A0A5C3Q8V1   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-41SNSTPRPRQSRSRKFLNPSDPSPKRRSRAKPKVQHHLHPTHydrophilic
NLS Segment(s)
PositionSequence
10-33QSRSRKFLNPSDPSPKRRSRAKPK
57-58RK
Subcellular Location(s) mito 17, nucl 6, cyto_nucl 6, cyto 4
Family & Domain DBs
Amino Acid Sequences MSNSTPRPRQSRSRKFLNPSDPSPKRRSRAKPKVQHHLHPTPSVLAELWTTRAIGKRKRVVVERGKAIPKAPVQPTLSTIQAPLEPPEHVRQQLLKDIDAWAKFIAQNPDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.8
3 0.83
4 0.82
5 0.77
6 0.73
7 0.76
8 0.73
9 0.71
10 0.72
11 0.7
12 0.67
13 0.7
14 0.74
15 0.74
16 0.78
17 0.83
18 0.84
19 0.84
20 0.89
21 0.85
22 0.82
23 0.79
24 0.76
25 0.69
26 0.6
27 0.53
28 0.43
29 0.37
30 0.29
31 0.2
32 0.13
33 0.1
34 0.09
35 0.09
36 0.08
37 0.08
38 0.09
39 0.14
40 0.18
41 0.23
42 0.3
43 0.34
44 0.38
45 0.41
46 0.45
47 0.49
48 0.53
49 0.53
50 0.5
51 0.49
52 0.48
53 0.45
54 0.41
55 0.37
56 0.31
57 0.32
58 0.29
59 0.31
60 0.31
61 0.31
62 0.33
63 0.31
64 0.29
65 0.23
66 0.21
67 0.16
68 0.15
69 0.15
70 0.14
71 0.13
72 0.13
73 0.16
74 0.2
75 0.23
76 0.23
77 0.25
78 0.26
79 0.28
80 0.35
81 0.34
82 0.3
83 0.27
84 0.29
85 0.32
86 0.29
87 0.27
88 0.2
89 0.2
90 0.21
91 0.25