Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3QNX4

Protein Details
Accession A0A5C3QNX4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
55-76STETIKQKKRLVRNRAHSSARSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, cyto 4.5, cyto_nucl 4, extr 3
Family & Domain DBs
Amino Acid Sequences MLLILHLHLLVCKRSRVEGTTVKPGPGPIALDIVLSQATGSGSTVTIRLPYMHGSTETIKQKKRLVRNRAHSSARSSNLVFIGIRSLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.28
3 0.29
4 0.34
5 0.37
6 0.4
7 0.47
8 0.46
9 0.43
10 0.4
11 0.37
12 0.32
13 0.24
14 0.2
15 0.11
16 0.12
17 0.11
18 0.1
19 0.1
20 0.09
21 0.08
22 0.06
23 0.05
24 0.04
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.04
31 0.05
32 0.05
33 0.05
34 0.05
35 0.06
36 0.07
37 0.08
38 0.09
39 0.1
40 0.1
41 0.12
42 0.14
43 0.21
44 0.28
45 0.32
46 0.34
47 0.38
48 0.44
49 0.5
50 0.58
51 0.62
52 0.64
53 0.69
54 0.76
55 0.81
56 0.82
57 0.8
58 0.73
59 0.71
60 0.68
61 0.62
62 0.55
63 0.46
64 0.41
65 0.36
66 0.35
67 0.27
68 0.19