Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3QIE6

Protein Details
Accession A0A5C3QIE6   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
6-25ARCSKASRRALTPKRGNKDFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR019189  Ribosomal_L27/L41_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
Pfam View protein in Pfam  
PF09809  MRP-L27  
Amino Acid Sequences MFPTVARCSKASRRALTPKRGNKDFYKGTGQARLPGGHRTGAPGEHVIRGQAKYRLLDEKVRVFVAPPIESINASPLKPYVSASVILKKTEERKVFGKLPVMGLTAQHFLDVSMARNKTATALEKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.74
3 0.77
4 0.79
5 0.79
6 0.8
7 0.8
8 0.76
9 0.71
10 0.71
11 0.65
12 0.59
13 0.57
14 0.51
15 0.49
16 0.51
17 0.46
18 0.42
19 0.39
20 0.37
21 0.31
22 0.31
23 0.29
24 0.23
25 0.22
26 0.2
27 0.19
28 0.18
29 0.17
30 0.16
31 0.16
32 0.15
33 0.15
34 0.14
35 0.15
36 0.16
37 0.17
38 0.18
39 0.18
40 0.18
41 0.2
42 0.23
43 0.22
44 0.26
45 0.26
46 0.26
47 0.25
48 0.25
49 0.22
50 0.19
51 0.19
52 0.17
53 0.14
54 0.11
55 0.11
56 0.11
57 0.12
58 0.11
59 0.13
60 0.12
61 0.12
62 0.12
63 0.11
64 0.11
65 0.12
66 0.13
67 0.11
68 0.1
69 0.12
70 0.14
71 0.21
72 0.21
73 0.21
74 0.21
75 0.23
76 0.27
77 0.34
78 0.35
79 0.32
80 0.33
81 0.4
82 0.43
83 0.43
84 0.43
85 0.36
86 0.36
87 0.33
88 0.32
89 0.25
90 0.22
91 0.21
92 0.18
93 0.16
94 0.13
95 0.12
96 0.1
97 0.13
98 0.13
99 0.13
100 0.19
101 0.2
102 0.2
103 0.21
104 0.21
105 0.21
106 0.25