Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3R0C6

Protein Details
Accession A0A5C3R0C6    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGKRKKSARKPGPSRGKDPLDBasic
NLS Segment(s)
PositionSequence
3-17KRKKSARKPGPSRGK
Subcellular Location(s) mito 13, cyto_nucl 8, nucl 7, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSARKPGPSRGKDPLDTTFTCLFCHHDNSVTVRVDRKEGVANLVCKVCDQRYQSKVTHLTEAVDIYSEWIDAADAAEKARDRPSRAGASSSIRPVAAPASVDDSDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.82
3 0.77
4 0.69
5 0.64
6 0.58
7 0.53
8 0.47
9 0.46
10 0.42
11 0.35
12 0.33
13 0.3
14 0.28
15 0.24
16 0.28
17 0.23
18 0.21
19 0.22
20 0.25
21 0.3
22 0.28
23 0.27
24 0.27
25 0.26
26 0.26
27 0.24
28 0.22
29 0.2
30 0.18
31 0.22
32 0.21
33 0.21
34 0.21
35 0.21
36 0.19
37 0.16
38 0.17
39 0.14
40 0.16
41 0.19
42 0.25
43 0.28
44 0.33
45 0.33
46 0.37
47 0.41
48 0.37
49 0.36
50 0.28
51 0.26
52 0.22
53 0.21
54 0.15
55 0.1
56 0.09
57 0.07
58 0.07
59 0.06
60 0.05
61 0.05
62 0.04
63 0.04
64 0.05
65 0.05
66 0.05
67 0.05
68 0.08
69 0.08
70 0.1
71 0.18
72 0.21
73 0.24
74 0.29
75 0.36
76 0.4
77 0.42
78 0.43
79 0.39
80 0.41
81 0.41
82 0.39
83 0.34
84 0.27
85 0.26
86 0.24
87 0.22
88 0.17
89 0.14
90 0.12
91 0.17
92 0.17