Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3PZU5

Protein Details
Accession A0A5C3PZU5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
32-55RRSPYYLRPTKKPHRYRSCGGRRIBasic
NLS Segment(s)
Subcellular Location(s) extr 26
Family & Domain DBs
Amino Acid Sequences MLSIKALVLVSIALISTVLAQDAQDEFDSYDRRSPYYLRPTKKPHRYRSCGGRRIETRGCPRGYVCVDDPYVGGCGMACDAPGICVKPNTFCGGFAGFRCKGEKRCVDNSSDDCSSLNGGADCGGICV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.04
6 0.04
7 0.04
8 0.06
9 0.07
10 0.08
11 0.08
12 0.09
13 0.09
14 0.12
15 0.15
16 0.14
17 0.19
18 0.18
19 0.19
20 0.2
21 0.23
22 0.28
23 0.37
24 0.44
25 0.45
26 0.52
27 0.61
28 0.7
29 0.78
30 0.79
31 0.79
32 0.81
33 0.83
34 0.82
35 0.83
36 0.83
37 0.8
38 0.72
39 0.69
40 0.61
41 0.61
42 0.58
43 0.53
44 0.5
45 0.49
46 0.47
47 0.4
48 0.38
49 0.36
50 0.33
51 0.29
52 0.23
53 0.19
54 0.19
55 0.18
56 0.18
57 0.13
58 0.13
59 0.09
60 0.08
61 0.05
62 0.05
63 0.05
64 0.05
65 0.04
66 0.03
67 0.03
68 0.05
69 0.06
70 0.07
71 0.07
72 0.1
73 0.11
74 0.13
75 0.15
76 0.18
77 0.17
78 0.17
79 0.18
80 0.19
81 0.2
82 0.19
83 0.24
84 0.21
85 0.22
86 0.25
87 0.28
88 0.3
89 0.37
90 0.45
91 0.46
92 0.53
93 0.55
94 0.55
95 0.58
96 0.57
97 0.55
98 0.47
99 0.4
100 0.32
101 0.3
102 0.27
103 0.2
104 0.18
105 0.12
106 0.11
107 0.11
108 0.11