Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3QYY3

Protein Details
Accession A0A5C3QYY3   
Localization Confidence Medium
Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
20-43NCPSHHGHRRCYHQRHRHHLQRESBasic
65-87TDILCCRCGKRRRSSGRAGRRRVHydrophilic
NLS Segment(s)
PositionSequence
74-87KRRRSSGRAGRRRV
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 8
Family & Domain DBs
Amino Acid Sequences MTGLRILCYRTRHQLCHLRNCPSHHGHRRCYHQRHRHHLQRESHPHSPTQLHTQLTIVCSFQVITDILCCRCGKRRRSSGRAGRRRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.63
3 0.69
4 0.7
5 0.68
6 0.67
7 0.68
8 0.66
9 0.63
10 0.65
11 0.65
12 0.66
13 0.66
14 0.68
15 0.73
16 0.76
17 0.79
18 0.8
19 0.78
20 0.81
21 0.82
22 0.85
23 0.84
24 0.82
25 0.8
26 0.76
27 0.77
28 0.77
29 0.74
30 0.7
31 0.62
32 0.54
33 0.48
34 0.43
35 0.35
36 0.32
37 0.29
38 0.25
39 0.24
40 0.25
41 0.23
42 0.22
43 0.21
44 0.14
45 0.09
46 0.09
47 0.09
48 0.07
49 0.08
50 0.07
51 0.06
52 0.09
53 0.12
54 0.12
55 0.15
56 0.16
57 0.17
58 0.27
59 0.35
60 0.42
61 0.5
62 0.6
63 0.68
64 0.76
65 0.84
66 0.85
67 0.88