Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3QGZ5

Protein Details
Accession A0A5C3QGZ5    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
43-74HATRRTPPPPPPRPPPKKKTKKEIEREEKWEEBasic
NLS Segment(s)
PositionSequence
45-65TRRTPPPPPPRPPPKKKTKKE
Subcellular Location(s) nucl 17.5, mito_nucl 13.666, cyto_nucl 10.333, mito 8.5
Family & Domain DBs
Amino Acid Sequences MSELIRRVNSQPGSPFISSPSARPYSPYLKTSKSLLSKIAPLHATRRTPPPPPPRPPPKKKTKKEIEREEKWEEEVIDGVGGINEWAALAEEERKSMLRAKMEMEMGGWD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.34
3 0.28
4 0.33
5 0.29
6 0.28
7 0.31
8 0.28
9 0.27
10 0.29
11 0.32
12 0.33
13 0.37
14 0.39
15 0.37
16 0.37
17 0.39
18 0.39
19 0.41
20 0.38
21 0.35
22 0.34
23 0.31
24 0.32
25 0.31
26 0.32
27 0.26
28 0.23
29 0.26
30 0.28
31 0.28
32 0.27
33 0.33
34 0.33
35 0.35
36 0.43
37 0.49
38 0.53
39 0.57
40 0.64
41 0.68
42 0.75
43 0.8
44 0.81
45 0.81
46 0.83
47 0.85
48 0.86
49 0.86
50 0.86
51 0.87
52 0.89
53 0.87
54 0.83
55 0.82
56 0.75
57 0.65
58 0.56
59 0.47
60 0.36
61 0.27
62 0.2
63 0.14
64 0.09
65 0.08
66 0.06
67 0.05
68 0.04
69 0.03
70 0.03
71 0.02
72 0.02
73 0.03
74 0.03
75 0.04
76 0.05
77 0.09
78 0.1
79 0.11
80 0.12
81 0.13
82 0.14
83 0.21
84 0.25
85 0.25
86 0.27
87 0.29
88 0.33
89 0.34
90 0.32