Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3R0M3

Protein Details
Accession A0A5C3R0M3   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
116-135AARSSAKPKQQSKSPPRSSSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, mito 3, cyto 2, pero 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039577  Rad18  
IPR003034  SAP_dom  
Gene Ontology GO:0003697  F:single-stranded DNA binding  
GO:0061630  F:ubiquitin protein ligase activity  
GO:0006301  P:postreplication repair  
GO:0006513  P:protein monoubiquitination  
Amino Acid Sequences MQLDEDTDPLPKPTYHTMKDKQLKDLLVKYGLPVTGARDVWTARHKQWVLLFNSNLDRSPSRRMTYEQLHAELSKWERQTSLLDPSKRAAKLKFDVEDSAAYAKAHKDQFDALVAAARSSAKPKQQSKSPPRSSSPEDVDLARSSPPILS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.38
3 0.47
4 0.52
5 0.6
6 0.69
7 0.67
8 0.64
9 0.61
10 0.59
11 0.55
12 0.53
13 0.46
14 0.4
15 0.37
16 0.31
17 0.28
18 0.25
19 0.2
20 0.16
21 0.16
22 0.17
23 0.17
24 0.17
25 0.16
26 0.16
27 0.19
28 0.25
29 0.25
30 0.22
31 0.31
32 0.3
33 0.32
34 0.37
35 0.41
36 0.4
37 0.42
38 0.41
39 0.34
40 0.37
41 0.35
42 0.3
43 0.25
44 0.21
45 0.19
46 0.26
47 0.27
48 0.26
49 0.27
50 0.29
51 0.32
52 0.35
53 0.39
54 0.34
55 0.31
56 0.3
57 0.28
58 0.25
59 0.22
60 0.2
61 0.18
62 0.17
63 0.15
64 0.15
65 0.16
66 0.18
67 0.18
68 0.25
69 0.26
70 0.27
71 0.28
72 0.29
73 0.34
74 0.32
75 0.33
76 0.26
77 0.27
78 0.3
79 0.34
80 0.34
81 0.3
82 0.3
83 0.28
84 0.26
85 0.21
86 0.18
87 0.13
88 0.11
89 0.11
90 0.11
91 0.15
92 0.16
93 0.16
94 0.16
95 0.17
96 0.18
97 0.19
98 0.19
99 0.13
100 0.15
101 0.14
102 0.12
103 0.12
104 0.11
105 0.1
106 0.14
107 0.19
108 0.22
109 0.32
110 0.39
111 0.46
112 0.54
113 0.64
114 0.71
115 0.78
116 0.8
117 0.78
118 0.76
119 0.77
120 0.75
121 0.72
122 0.68
123 0.61
124 0.53
125 0.48
126 0.45
127 0.39
128 0.33
129 0.26
130 0.2