Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3QY85

Protein Details
Accession A0A5C3QY85   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
5-26ASTFRTCACRRLPTKRHVLPLNHydrophilic
39-63LDYEALKKQRRTEWKRRQGTQSFLDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR031167  G_OBG  
IPR006073  GTP-bd  
IPR006169  GTP1_OBG_dom  
IPR036726  GTP1_OBG_dom_sf  
IPR045086  OBG_GTPase  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF01018  GTP1_OBG  
PF01926  MMR_HSR1  
PROSITE View protein in PROSITE  
PS51710  G_OBG  
PS51883  OBG  
CDD cd01898  Obg  
Amino Acid Sequences MLPRASTFRTCACRRLPTKRHVLPLNQTTRFYSVDAEKLDYEALKKQRRTEWKRRQGTQSFLDHLIINVRGGKGGNGCAAFHREKFINFGPPCGGAGGRGGDVYIMPTKELTTLASITKQVRGQPGSSGSGTWQNGRAGEPTIIKVPLGTVVRELGPEDTRRALDEWEQEEEDLKGMEAEDMKAKMREKRWLHFPGSADDNNGRDAFLEAEKVIYKEERQRRLAARKRALEPLSFDLDKIEELENPVDAPLGVRKTEYLGHLIAHGGAGGVGNTHFVTNDNRSPKYATRGHDGERRTYMLELKLIADIGLVGMPNAGKSTLLRALTGGRAKSEVASYAFTTLNPVVGVVRVAADGTFEGSLRPIRTFDETRVEEEQALAALDAIVDPNEVSLPPAEEPSVRAGHEFDLLETSRFTIADNPGLISGASENVGLGHSFLKSIERSLALAYVIDLSAPAPWDELQVLRDELEHYQPGMSSKARIVIANKADLLGGGGDPEAVEEAKAKLQRLEEYVRENVQADRPLDVVPVSAKFSQNAAKVVRLLNGYVQEAKAEAGAEAEAEVKVET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.71
3 0.72
4 0.73
5 0.8
6 0.8
7 0.82
8 0.79
9 0.78
10 0.77
11 0.78
12 0.78
13 0.71
14 0.66
15 0.6
16 0.56
17 0.49
18 0.4
19 0.35
20 0.29
21 0.31
22 0.31
23 0.31
24 0.28
25 0.27
26 0.27
27 0.23
28 0.22
29 0.24
30 0.32
31 0.38
32 0.41
33 0.48
34 0.56
35 0.66
36 0.74
37 0.77
38 0.79
39 0.81
40 0.87
41 0.88
42 0.89
43 0.85
44 0.83
45 0.79
46 0.75
47 0.68
48 0.6
49 0.54
50 0.43
51 0.36
52 0.32
53 0.25
54 0.19
55 0.17
56 0.16
57 0.15
58 0.16
59 0.17
60 0.16
61 0.17
62 0.2
63 0.18
64 0.18
65 0.19
66 0.25
67 0.26
68 0.25
69 0.27
70 0.26
71 0.25
72 0.31
73 0.32
74 0.36
75 0.33
76 0.34
77 0.31
78 0.3
79 0.3
80 0.25
81 0.22
82 0.12
83 0.14
84 0.13
85 0.11
86 0.1
87 0.09
88 0.08
89 0.08
90 0.1
91 0.12
92 0.11
93 0.11
94 0.11
95 0.12
96 0.13
97 0.13
98 0.12
99 0.1
100 0.12
101 0.13
102 0.15
103 0.18
104 0.19
105 0.23
106 0.24
107 0.25
108 0.3
109 0.32
110 0.31
111 0.31
112 0.33
113 0.32
114 0.3
115 0.27
116 0.22
117 0.26
118 0.26
119 0.24
120 0.24
121 0.22
122 0.22
123 0.23
124 0.23
125 0.18
126 0.2
127 0.2
128 0.18
129 0.19
130 0.18
131 0.17
132 0.15
133 0.13
134 0.15
135 0.15
136 0.14
137 0.12
138 0.13
139 0.14
140 0.14
141 0.15
142 0.12
143 0.14
144 0.15
145 0.16
146 0.17
147 0.17
148 0.18
149 0.19
150 0.18
151 0.19
152 0.24
153 0.24
154 0.25
155 0.25
156 0.24
157 0.23
158 0.22
159 0.18
160 0.12
161 0.09
162 0.06
163 0.06
164 0.07
165 0.07
166 0.07
167 0.1
168 0.11
169 0.12
170 0.15
171 0.18
172 0.23
173 0.26
174 0.35
175 0.37
176 0.42
177 0.5
178 0.53
179 0.54
180 0.52
181 0.5
182 0.44
183 0.44
184 0.39
185 0.32
186 0.28
187 0.25
188 0.23
189 0.21
190 0.17
191 0.12
192 0.12
193 0.11
194 0.09
195 0.1
196 0.08
197 0.09
198 0.09
199 0.09
200 0.1
201 0.09
202 0.12
203 0.2
204 0.28
205 0.35
206 0.37
207 0.42
208 0.49
209 0.59
210 0.65
211 0.66
212 0.66
213 0.64
214 0.65
215 0.66
216 0.6
217 0.51
218 0.46
219 0.39
220 0.36
221 0.3
222 0.27
223 0.2
224 0.18
225 0.17
226 0.15
227 0.12
228 0.07
229 0.09
230 0.09
231 0.09
232 0.08
233 0.08
234 0.06
235 0.05
236 0.06
237 0.07
238 0.08
239 0.08
240 0.08
241 0.08
242 0.1
243 0.12
244 0.13
245 0.12
246 0.11
247 0.11
248 0.12
249 0.12
250 0.1
251 0.08
252 0.07
253 0.04
254 0.03
255 0.03
256 0.03
257 0.03
258 0.02
259 0.03
260 0.04
261 0.04
262 0.04
263 0.05
264 0.08
265 0.11
266 0.17
267 0.2
268 0.21
269 0.22
270 0.25
271 0.25
272 0.3
273 0.32
274 0.29
275 0.31
276 0.33
277 0.36
278 0.38
279 0.38
280 0.34
281 0.3
282 0.29
283 0.24
284 0.22
285 0.21
286 0.17
287 0.16
288 0.13
289 0.12
290 0.11
291 0.1
292 0.09
293 0.06
294 0.05
295 0.04
296 0.04
297 0.03
298 0.03
299 0.03
300 0.03
301 0.03
302 0.04
303 0.04
304 0.03
305 0.04
306 0.07
307 0.11
308 0.11
309 0.11
310 0.12
311 0.13
312 0.17
313 0.2
314 0.17
315 0.13
316 0.14
317 0.14
318 0.14
319 0.13
320 0.11
321 0.1
322 0.11
323 0.11
324 0.12
325 0.12
326 0.11
327 0.14
328 0.12
329 0.11
330 0.09
331 0.09
332 0.07
333 0.07
334 0.07
335 0.04
336 0.05
337 0.04
338 0.04
339 0.04
340 0.04
341 0.04
342 0.05
343 0.05
344 0.05
345 0.05
346 0.06
347 0.08
348 0.09
349 0.1
350 0.1
351 0.12
352 0.17
353 0.19
354 0.21
355 0.28
356 0.28
357 0.31
358 0.33
359 0.32
360 0.26
361 0.24
362 0.21
363 0.13
364 0.11
365 0.08
366 0.05
367 0.04
368 0.04
369 0.03
370 0.03
371 0.03
372 0.03
373 0.03
374 0.03
375 0.04
376 0.04
377 0.04
378 0.05
379 0.06
380 0.07
381 0.08
382 0.08
383 0.08
384 0.1
385 0.13
386 0.15
387 0.13
388 0.13
389 0.14
390 0.14
391 0.17
392 0.16
393 0.12
394 0.14
395 0.14
396 0.14
397 0.13
398 0.14
399 0.11
400 0.11
401 0.11
402 0.13
403 0.14
404 0.17
405 0.17
406 0.17
407 0.16
408 0.16
409 0.16
410 0.11
411 0.09
412 0.06
413 0.06
414 0.06
415 0.05
416 0.05
417 0.06
418 0.06
419 0.06
420 0.06
421 0.06
422 0.06
423 0.07
424 0.1
425 0.1
426 0.12
427 0.13
428 0.13
429 0.14
430 0.14
431 0.15
432 0.12
433 0.11
434 0.1
435 0.09
436 0.07
437 0.07
438 0.06
439 0.05
440 0.06
441 0.07
442 0.06
443 0.07
444 0.07
445 0.08
446 0.09
447 0.1
448 0.1
449 0.12
450 0.13
451 0.12
452 0.12
453 0.13
454 0.14
455 0.17
456 0.17
457 0.15
458 0.15
459 0.16
460 0.17
461 0.19
462 0.18
463 0.16
464 0.16
465 0.21
466 0.22
467 0.24
468 0.24
469 0.29
470 0.31
471 0.32
472 0.31
473 0.26
474 0.25
475 0.22
476 0.2
477 0.12
478 0.09
479 0.06
480 0.06
481 0.05
482 0.05
483 0.06
484 0.06
485 0.05
486 0.06
487 0.07
488 0.08
489 0.14
490 0.17
491 0.18
492 0.2
493 0.23
494 0.27
495 0.31
496 0.36
497 0.35
498 0.38
499 0.41
500 0.39
501 0.38
502 0.35
503 0.33
504 0.32
505 0.34
506 0.29
507 0.27
508 0.26
509 0.25
510 0.24
511 0.21
512 0.17
513 0.14
514 0.15
515 0.17
516 0.19
517 0.2
518 0.2
519 0.23
520 0.28
521 0.29
522 0.33
523 0.32
524 0.32
525 0.34
526 0.35
527 0.35
528 0.31
529 0.28
530 0.27
531 0.27
532 0.27
533 0.27
534 0.25
535 0.22
536 0.2
537 0.2
538 0.16
539 0.13
540 0.1
541 0.08
542 0.08
543 0.08
544 0.07
545 0.08
546 0.07