Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3QHW8

Protein Details
Accession A0A5C3QHW8   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
34-57SQPAAKGKKTPKPRVKQTPKTAADHydrophilic
NLS Segment(s)
PositionSequence
33-49KSQPAAKGKKTPKPRVK
Subcellular Location(s) nucl 13, cyto_nucl 10.5, mito 9, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR025715  FoP_C  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF13865  FoP_duplication  
Amino Acid Sequences MKIEIILDPSKPQPLAARVGPPPANGNANAGAKSQPAAKGKKTPKPRVKQTPKTAADLDAEMEDYTASSAAPAASSAAASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.28
3 0.28
4 0.31
5 0.29
6 0.35
7 0.34
8 0.3
9 0.29
10 0.26
11 0.26
12 0.21
13 0.21
14 0.19
15 0.19
16 0.19
17 0.17
18 0.15
19 0.13
20 0.14
21 0.13
22 0.14
23 0.19
24 0.21
25 0.23
26 0.32
27 0.38
28 0.45
29 0.53
30 0.59
31 0.64
32 0.7
33 0.78
34 0.8
35 0.85
36 0.87
37 0.87
38 0.87
39 0.79
40 0.74
41 0.65
42 0.56
43 0.46
44 0.37
45 0.28
46 0.18
47 0.16
48 0.11
49 0.1
50 0.08
51 0.06
52 0.06
53 0.05
54 0.05
55 0.04
56 0.04
57 0.05
58 0.05
59 0.05
60 0.06
61 0.06