Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3QHK3

Protein Details
Accession A0A5C3QHK3    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
10-37SSSSGGKSAKKKKWSKGKVKDKAQHAVSHydrophilic
NLS Segment(s)
PositionSequence
14-31GGKSAKKKKWSKGKVKDK
Subcellular Location(s) mito 16, cyto_nucl 6, nucl 5.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAKAAVPSSSSGGKSAKKKKWSKGKVKDKAQHAVSLDKPTFDRIMKEVPTFRFISQSILIERLKIGGSLARVAIRHLERDGLIKRIVHHSGQLVYTRATAGTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.3
3 0.38
4 0.45
5 0.51
6 0.58
7 0.66
8 0.73
9 0.8
10 0.84
11 0.86
12 0.87
13 0.9
14 0.89
15 0.91
16 0.89
17 0.84
18 0.81
19 0.72
20 0.65
21 0.55
22 0.5
23 0.42
24 0.41
25 0.35
26 0.28
27 0.26
28 0.24
29 0.25
30 0.2
31 0.19
32 0.14
33 0.19
34 0.2
35 0.21
36 0.23
37 0.22
38 0.25
39 0.25
40 0.23
41 0.21
42 0.19
43 0.21
44 0.18
45 0.18
46 0.15
47 0.18
48 0.17
49 0.15
50 0.15
51 0.12
52 0.11
53 0.09
54 0.09
55 0.07
56 0.08
57 0.09
58 0.1
59 0.1
60 0.1
61 0.11
62 0.17
63 0.16
64 0.17
65 0.17
66 0.18
67 0.17
68 0.23
69 0.25
70 0.22
71 0.23
72 0.23
73 0.25
74 0.29
75 0.32
76 0.27
77 0.27
78 0.27
79 0.28
80 0.29
81 0.29
82 0.25
83 0.23
84 0.22
85 0.2