Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3R4X4

Protein Details
Accession A0A5C3R4X4    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
82-122LDLRAKKTRAIRRRLTKNEKSQKTLKQRKKELNFPTRKYAVHydrophilic
NLS Segment(s)
PositionSequence
85-113RAKKTRAIRRRLTKNEKSQKTLKQRKKEL
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPGKVKAYELQSKSKNDLSKQLAELKGELLSLRVQKIAGGSASKLTKINVVRKSVARVLTVMNQKARQNLREYYKDKKYLPLDLRAKKTRAIRRRLTKNEKSQKTLKQRKKELNFPTRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.55
3 0.48
4 0.53
5 0.5
6 0.49
7 0.48
8 0.51
9 0.47
10 0.43
11 0.4
12 0.32
13 0.26
14 0.21
15 0.17
16 0.11
17 0.12
18 0.13
19 0.13
20 0.13
21 0.12
22 0.13
23 0.13
24 0.13
25 0.11
26 0.1
27 0.09
28 0.13
29 0.14
30 0.14
31 0.14
32 0.13
33 0.17
34 0.21
35 0.29
36 0.3
37 0.33
38 0.35
39 0.35
40 0.39
41 0.37
42 0.34
43 0.26
44 0.22
45 0.2
46 0.23
47 0.26
48 0.24
49 0.23
50 0.24
51 0.24
52 0.3
53 0.31
54 0.28
55 0.28
56 0.31
57 0.35
58 0.4
59 0.43
60 0.44
61 0.49
62 0.52
63 0.49
64 0.51
65 0.48
66 0.48
67 0.49
68 0.51
69 0.53
70 0.54
71 0.61
72 0.6
73 0.59
74 0.55
75 0.6
76 0.61
77 0.61
78 0.63
79 0.65
80 0.7
81 0.79
82 0.85
83 0.86
84 0.86
85 0.88
86 0.9
87 0.86
88 0.82
89 0.8
90 0.79
91 0.8
92 0.81
93 0.8
94 0.8
95 0.83
96 0.87
97 0.88
98 0.88
99 0.87
100 0.87
101 0.88
102 0.82
103 0.81
104 0.76