Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3R0Q9

Protein Details
Accession A0A5C3R0Q9    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
353-378AEAPESKYEGKKRKRSRFEAEQGLVKHydrophilic
NLS Segment(s)
PositionSequence
335-386RGKRKAVLERSRGAGDEPAEAPESKYEGKKRKRSRFEAEQGLVKRKLARNKS
Subcellular Location(s) nucl 17, cyto_nucl 13.5, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR007146  Sas10/Utp3/C1D  
Pfam View protein in Pfam  
PF04000  Sas10_Utp3  
Amino Acid Sequences MVTPRMSSQVTSDHDFKSLLEEMGDSIAAARVVIQNLNKKKDASSESLNTKDGISLLSMKNHLLLSYLQSLTLLTPLKLLGESLTNRSPPSLPFSNPNREARGSDAGDLVDSMVEGRLVLEKVKILEERLRYQIDKLVRLAKEDQNAPVDETLAFKPNPANFADDDESDAGSDAGYNGGAAPESEPEDGIYRPPRIAAVPYTGTAGKKTKGRREAIPQTLAALRYHDASMPHIETTSGLGSMPSLQSRRARELKEMQDYEEENFTRLVLGKKESKQRARDEADVALGGGGELNGVNGRRRRGAGGLEDEFGDVLRSVDRVPKRGTADGYDDLRQRGKRKAVLERSRGAGDEPAEAPESKYEGKKRKRSRFEAEQGLVKRKLARNKSSGSGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.33
3 0.3
4 0.28
5 0.26
6 0.21
7 0.17
8 0.16
9 0.15
10 0.16
11 0.16
12 0.1
13 0.08
14 0.08
15 0.08
16 0.07
17 0.08
18 0.09
19 0.11
20 0.15
21 0.19
22 0.28
23 0.36
24 0.42
25 0.43
26 0.42
27 0.42
28 0.47
29 0.48
30 0.45
31 0.45
32 0.47
33 0.5
34 0.52
35 0.52
36 0.44
37 0.38
38 0.33
39 0.25
40 0.18
41 0.13
42 0.16
43 0.16
44 0.2
45 0.2
46 0.2
47 0.22
48 0.21
49 0.19
50 0.16
51 0.15
52 0.15
53 0.2
54 0.19
55 0.17
56 0.17
57 0.17
58 0.15
59 0.19
60 0.16
61 0.1
62 0.11
63 0.11
64 0.12
65 0.11
66 0.11
67 0.08
68 0.12
69 0.14
70 0.18
71 0.21
72 0.22
73 0.22
74 0.24
75 0.24
76 0.2
77 0.26
78 0.25
79 0.24
80 0.31
81 0.38
82 0.46
83 0.51
84 0.53
85 0.5
86 0.48
87 0.47
88 0.44
89 0.44
90 0.35
91 0.3
92 0.27
93 0.22
94 0.21
95 0.19
96 0.14
97 0.07
98 0.06
99 0.05
100 0.04
101 0.04
102 0.03
103 0.04
104 0.06
105 0.06
106 0.07
107 0.08
108 0.09
109 0.1
110 0.12
111 0.13
112 0.13
113 0.18
114 0.22
115 0.25
116 0.28
117 0.3
118 0.28
119 0.29
120 0.31
121 0.29
122 0.28
123 0.27
124 0.3
125 0.27
126 0.3
127 0.34
128 0.32
129 0.33
130 0.32
131 0.32
132 0.28
133 0.28
134 0.25
135 0.21
136 0.17
137 0.13
138 0.14
139 0.13
140 0.13
141 0.13
142 0.12
143 0.16
144 0.16
145 0.18
146 0.16
147 0.18
148 0.15
149 0.19
150 0.2
151 0.17
152 0.17
153 0.16
154 0.15
155 0.12
156 0.12
157 0.07
158 0.05
159 0.05
160 0.04
161 0.03
162 0.03
163 0.03
164 0.03
165 0.03
166 0.03
167 0.03
168 0.03
169 0.04
170 0.06
171 0.06
172 0.06
173 0.06
174 0.08
175 0.08
176 0.1
177 0.12
178 0.12
179 0.12
180 0.12
181 0.12
182 0.11
183 0.13
184 0.11
185 0.12
186 0.12
187 0.12
188 0.14
189 0.14
190 0.14
191 0.15
192 0.16
193 0.15
194 0.19
195 0.25
196 0.32
197 0.38
198 0.42
199 0.44
200 0.51
201 0.58
202 0.58
203 0.54
204 0.46
205 0.4
206 0.39
207 0.35
208 0.25
209 0.18
210 0.13
211 0.12
212 0.12
213 0.12
214 0.1
215 0.11
216 0.14
217 0.13
218 0.13
219 0.12
220 0.12
221 0.1
222 0.11
223 0.1
224 0.07
225 0.06
226 0.06
227 0.06
228 0.07
229 0.08
230 0.09
231 0.09
232 0.13
233 0.18
234 0.22
235 0.29
236 0.34
237 0.35
238 0.4
239 0.48
240 0.51
241 0.55
242 0.52
243 0.46
244 0.44
245 0.43
246 0.37
247 0.34
248 0.27
249 0.19
250 0.18
251 0.16
252 0.13
253 0.14
254 0.16
255 0.13
256 0.17
257 0.24
258 0.3
259 0.39
260 0.48
261 0.53
262 0.58
263 0.63
264 0.68
265 0.66
266 0.64
267 0.57
268 0.49
269 0.42
270 0.34
271 0.27
272 0.18
273 0.12
274 0.08
275 0.06
276 0.04
277 0.03
278 0.03
279 0.03
280 0.05
281 0.06
282 0.11
283 0.15
284 0.18
285 0.21
286 0.22
287 0.25
288 0.26
289 0.3
290 0.31
291 0.35
292 0.34
293 0.32
294 0.3
295 0.28
296 0.24
297 0.2
298 0.15
299 0.08
300 0.06
301 0.06
302 0.06
303 0.07
304 0.15
305 0.18
306 0.23
307 0.26
308 0.32
309 0.36
310 0.4
311 0.41
312 0.38
313 0.4
314 0.41
315 0.41
316 0.39
317 0.37
318 0.36
319 0.39
320 0.4
321 0.39
322 0.42
323 0.47
324 0.49
325 0.54
326 0.62
327 0.67
328 0.72
329 0.75
330 0.71
331 0.67
332 0.62
333 0.55
334 0.46
335 0.39
336 0.3
337 0.26
338 0.22
339 0.2
340 0.21
341 0.21
342 0.2
343 0.18
344 0.21
345 0.21
346 0.28
347 0.35
348 0.43
349 0.54
350 0.64
351 0.73
352 0.8
353 0.87
354 0.89
355 0.89
356 0.9
357 0.89
358 0.89
359 0.82
360 0.79
361 0.74
362 0.73
363 0.65
364 0.56
365 0.55
366 0.52
367 0.58
368 0.59
369 0.63
370 0.63
371 0.66