Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3QEJ3

Protein Details
Accession A0A5C3QEJ3    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-46AIKIPIVKKRTTKFKRHQSDRYHGVKEAWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
9-47KKRTTKFKRHQSDRYHGVKEAWRKPKGIDNRVRRRFKGQ
Subcellular Location(s) mito 13, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAIKIPIVKKRTTKFKRHQSDRYHGVKEAWRKPKGIDNRVRRRFKGQTAMPKIGYGSNKKTRHLLPNGLKKLVINNVREIDLLLMHNKSFAAEIAHNVSSRNRIGILERARALGVKVTNPAARLRSEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.82
3 0.87
4 0.88
5 0.89
6 0.87
7 0.88
8 0.86
9 0.83
10 0.75
11 0.65
12 0.6
13 0.56
14 0.56
15 0.56
16 0.57
17 0.52
18 0.5
19 0.5
20 0.55
21 0.59
22 0.59
23 0.59
24 0.61
25 0.7
26 0.78
27 0.83
28 0.76
29 0.74
30 0.71
31 0.67
32 0.66
33 0.61
34 0.62
35 0.63
36 0.64
37 0.56
38 0.5
39 0.44
40 0.38
41 0.35
42 0.29
43 0.29
44 0.35
45 0.37
46 0.38
47 0.41
48 0.42
49 0.45
50 0.45
51 0.47
52 0.45
53 0.53
54 0.55
55 0.51
56 0.47
57 0.39
58 0.38
59 0.36
60 0.33
61 0.24
62 0.25
63 0.26
64 0.26
65 0.26
66 0.23
67 0.17
68 0.12
69 0.12
70 0.1
71 0.09
72 0.09
73 0.09
74 0.09
75 0.08
76 0.08
77 0.07
78 0.09
79 0.09
80 0.11
81 0.15
82 0.16
83 0.16
84 0.17
85 0.18
86 0.19
87 0.19
88 0.18
89 0.15
90 0.15
91 0.18
92 0.25
93 0.29
94 0.3
95 0.3
96 0.3
97 0.3
98 0.29
99 0.27
100 0.24
101 0.21
102 0.17
103 0.2
104 0.23
105 0.24
106 0.26
107 0.29
108 0.26