Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3QRL2

Protein Details
Accession A0A5C3QRL2    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
47-75DGPGGRKEKADRKRANKQRLRENNFMKTQHydrophilic
NLS Segment(s)
PositionSequence
49-65PGGRKEKADRKRANKQR
Subcellular Location(s) nucl 19, cyto 4.5, cyto_mito 4, mito 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences PRSCCAADTILPGLNYLKGQKVVLAKADEEYPDWLWSIMEPREWKDDGPGGRKEKADRKRANKQRLRENNFMKTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.15
4 0.16
5 0.14
6 0.14
7 0.17
8 0.19
9 0.2
10 0.22
11 0.22
12 0.19
13 0.19
14 0.2
15 0.17
16 0.14
17 0.15
18 0.12
19 0.11
20 0.11
21 0.1
22 0.09
23 0.09
24 0.11
25 0.09
26 0.11
27 0.12
28 0.13
29 0.17
30 0.18
31 0.18
32 0.17
33 0.22
34 0.23
35 0.27
36 0.32
37 0.32
38 0.35
39 0.38
40 0.41
41 0.46
42 0.51
43 0.56
44 0.59
45 0.65
46 0.72
47 0.81
48 0.86
49 0.84
50 0.84
51 0.85
52 0.86
53 0.86
54 0.85
55 0.82