Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3QP55

Protein Details
Accession A0A5C3QP55    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MREKWKKKRSRRLRRKRRKMRARSSTCSFPHBasic
NLS Segment(s)
PositionSequence
3-23EKWKKKRSRRLRRKRRKMRAR
Subcellular Location(s) nucl 18, cyto_nucl 10.5, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR007836  Ribosomal_L41  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF05162  Ribosomal_L41  
Amino Acid Sequences MREKWKKKRSRRLRRKRRKMRARSSTCSFPHLAISNSNHSYLPLLQSNRTLTRISQRNPLLVQPNCIAVPQANDITRAARSTRSNATWHLQSALAVLYPRPPPFGLCVGIMG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.97
2 0.98
3 0.98
4 0.98
5 0.97
6 0.97
7 0.96
8 0.96
9 0.94
10 0.9
11 0.85
12 0.83
13 0.73
14 0.66
15 0.56
16 0.45
17 0.4
18 0.34
19 0.29
20 0.25
21 0.26
22 0.28
23 0.28
24 0.28
25 0.24
26 0.22
27 0.22
28 0.18
29 0.18
30 0.17
31 0.17
32 0.16
33 0.19
34 0.22
35 0.22
36 0.23
37 0.21
38 0.17
39 0.24
40 0.3
41 0.3
42 0.34
43 0.34
44 0.34
45 0.34
46 0.36
47 0.35
48 0.29
49 0.3
50 0.23
51 0.24
52 0.21
53 0.21
54 0.18
55 0.1
56 0.12
57 0.11
58 0.13
59 0.12
60 0.13
61 0.14
62 0.15
63 0.15
64 0.15
65 0.13
66 0.16
67 0.18
68 0.21
69 0.27
70 0.28
71 0.3
72 0.33
73 0.36
74 0.34
75 0.32
76 0.3
77 0.24
78 0.21
79 0.19
80 0.16
81 0.13
82 0.11
83 0.1
84 0.13
85 0.17
86 0.18
87 0.2
88 0.2
89 0.2
90 0.25
91 0.28
92 0.26