Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3QKD3

Protein Details
Accession A0A5C3QKD3   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
36-73IRDRMRDGKHRKQTDRTRRQNREVRKRVKEGKDSPTKHBasic
NLS Segment(s)
PositionSequence
33-73KDGIRDRMRDGKHRKQTDRTRRQNREVRKRVKEGKDSPTKH
Subcellular Location(s) nucl 20, cyto_nucl 11.833, mito 4
Family & Domain DBs
Amino Acid Sequences MGIETGQGQGRDEGRNEGREQGQDRNRNKDGMKDGIRDRMRDGKHRKQTDRTRRQNREVRKRVKEGKDSPTKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.3
3 0.3
4 0.31
5 0.31
6 0.33
7 0.34
8 0.36
9 0.41
10 0.46
11 0.49
12 0.53
13 0.53
14 0.52
15 0.49
16 0.47
17 0.43
18 0.42
19 0.41
20 0.37
21 0.36
22 0.41
23 0.42
24 0.37
25 0.35
26 0.35
27 0.34
28 0.39
29 0.47
30 0.48
31 0.57
32 0.65
33 0.68
34 0.7
35 0.79
36 0.81
37 0.83
38 0.84
39 0.86
40 0.86
41 0.9
42 0.89
43 0.89
44 0.89
45 0.88
46 0.88
47 0.85
48 0.87
49 0.87
50 0.87
51 0.86
52 0.83
53 0.83