Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3QX75

Protein Details
Accession A0A5C3QX75   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
11-33AKLYVLFHKRRRPHSKKHLTYVVHydrophilic
NLS Segment(s)
PositionSequence
20-24RRRPH
Subcellular Location(s) extr 8, mito 6, golg 6, E.R. 4, plas 1, pero 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MFGIHLVTGFAKLYVLFHKRRRPHSKKHLTYVVVLLVLGFINFVFFAVTNARRDDLDLDQPRNEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.2
3 0.26
4 0.34
5 0.43
6 0.5
7 0.61
8 0.71
9 0.72
10 0.77
11 0.82
12 0.86
13 0.83
14 0.83
15 0.79
16 0.69
17 0.62
18 0.53
19 0.42
20 0.3
21 0.23
22 0.15
23 0.08
24 0.07
25 0.05
26 0.03
27 0.02
28 0.03
29 0.03
30 0.03
31 0.03
32 0.03
33 0.05
34 0.1
35 0.12
36 0.14
37 0.16
38 0.17
39 0.17
40 0.19
41 0.21
42 0.21
43 0.29
44 0.34
45 0.36