Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3Q1P4

Protein Details
Accession A0A5C3Q1P4    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
77-98KKKSGTTETKPKKLPRLKDRLLBasic
NLS Segment(s)
PositionSequence
85-94TKPKKLPRLK
Subcellular Location(s) nucl 13, mito 9, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011011  Znf_FYVE_PHD  
IPR013083  Znf_RING/FYVE/PHD  
Amino Acid Sequences MFIFQCRCRRKGQDADIKEGRLQHKMGAAHLGGLIQCNQCLRWMHIACQRQDRADKLGEDVKFSCNWCGYLLQKDEKKKSGTTETKPKKLPRLKDRLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.75
3 0.71
4 0.65
5 0.58
6 0.53
7 0.44
8 0.38
9 0.34
10 0.27
11 0.28
12 0.26
13 0.25
14 0.23
15 0.21
16 0.17
17 0.16
18 0.15
19 0.1
20 0.1
21 0.11
22 0.08
23 0.09
24 0.08
25 0.09
26 0.12
27 0.13
28 0.15
29 0.21
30 0.22
31 0.26
32 0.32
33 0.37
34 0.36
35 0.41
36 0.4
37 0.33
38 0.35
39 0.32
40 0.29
41 0.27
42 0.25
43 0.21
44 0.25
45 0.22
46 0.23
47 0.22
48 0.2
49 0.19
50 0.2
51 0.19
52 0.15
53 0.16
54 0.14
55 0.16
56 0.17
57 0.22
58 0.26
59 0.31
60 0.36
61 0.44
62 0.48
63 0.51
64 0.52
65 0.48
66 0.49
67 0.53
68 0.56
69 0.57
70 0.62
71 0.66
72 0.72
73 0.77
74 0.78
75 0.78
76 0.78
77 0.8
78 0.8