Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3QXZ8

Protein Details
Accession A0A5C3QXZ8    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
233-257AELRRTVARSSRKRKRNPMFETRLEHydrophilic
NLS Segment(s)
PositionSequence
242-248SSRKRKR
Subcellular Location(s) nucl 13.5, cyto_nucl 9, mito 5, extr 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR037818  TAF8  
IPR019473  TFIID_su8_C  
Gene Ontology GO:0005669  C:transcription factor TFIID complex  
GO:0046982  F:protein heterodimerization activity  
Pfam View protein in Pfam  
PF10406  TAF8_C  
Amino Acid Sequences MSLQFNHYTPPAPSPSPSFSSTSPPPVGASSNYYTQAPNQTQTHGLQQLDGAVSNAALANLSSLSSLVSANGGTPFNLAAISNLNLSATTLASLGLSALIPGGGVTSPGGGGGYGTSPGGYGMHHAQSLASSLGLGGLGLHPMYSAKPPKGVPCVNGEIASRVVRRAVGRGLQDAGFVGVEGEEVIRRVEEEVVHLLERLFGDAHEYANLANRNQPVAKDVLEACNDAGLTPAELRRTVARSSRKRKRNPMFETRLEPCRDSPPPPALLPSDDEGAIPPIPATLRALPSFYPSLPPKHTYLQTPIIPTKKAALPSLEKKLNTAGLVQDSLRNLLIGTEETTNQEDAELLGHIVNWESAAHPRKRWKVGNVGGGRGRGGLGAGMIDSGGSGSGIGGSGLEELDLGKSSRRGGTGPMPFPLEINGRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.38
3 0.4
4 0.41
5 0.38
6 0.34
7 0.4
8 0.42
9 0.43
10 0.39
11 0.36
12 0.34
13 0.32
14 0.33
15 0.28
16 0.29
17 0.25
18 0.27
19 0.28
20 0.28
21 0.27
22 0.28
23 0.35
24 0.32
25 0.35
26 0.33
27 0.34
28 0.37
29 0.38
30 0.41
31 0.37
32 0.34
33 0.28
34 0.26
35 0.26
36 0.23
37 0.21
38 0.15
39 0.09
40 0.09
41 0.09
42 0.09
43 0.06
44 0.05
45 0.05
46 0.05
47 0.05
48 0.06
49 0.05
50 0.05
51 0.05
52 0.06
53 0.06
54 0.06
55 0.06
56 0.06
57 0.07
58 0.09
59 0.1
60 0.09
61 0.09
62 0.09
63 0.09
64 0.09
65 0.08
66 0.07
67 0.09
68 0.09
69 0.09
70 0.09
71 0.09
72 0.09
73 0.09
74 0.09
75 0.07
76 0.06
77 0.06
78 0.06
79 0.06
80 0.06
81 0.05
82 0.05
83 0.04
84 0.04
85 0.04
86 0.03
87 0.03
88 0.03
89 0.04
90 0.03
91 0.04
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.03
98 0.04
99 0.04
100 0.04
101 0.05
102 0.05
103 0.05
104 0.05
105 0.05
106 0.05
107 0.05
108 0.07
109 0.1
110 0.11
111 0.11
112 0.11
113 0.11
114 0.11
115 0.12
116 0.1
117 0.07
118 0.05
119 0.05
120 0.05
121 0.05
122 0.04
123 0.03
124 0.03
125 0.04
126 0.04
127 0.04
128 0.03
129 0.04
130 0.05
131 0.11
132 0.15
133 0.16
134 0.2
135 0.21
136 0.26
137 0.33
138 0.34
139 0.3
140 0.32
141 0.35
142 0.32
143 0.32
144 0.28
145 0.22
146 0.22
147 0.22
148 0.17
149 0.13
150 0.13
151 0.14
152 0.14
153 0.15
154 0.16
155 0.17
156 0.18
157 0.19
158 0.2
159 0.18
160 0.17
161 0.15
162 0.13
163 0.08
164 0.07
165 0.05
166 0.03
167 0.03
168 0.03
169 0.03
170 0.03
171 0.03
172 0.04
173 0.03
174 0.04
175 0.05
176 0.06
177 0.06
178 0.07
179 0.09
180 0.09
181 0.1
182 0.1
183 0.09
184 0.09
185 0.09
186 0.08
187 0.06
188 0.05
189 0.08
190 0.08
191 0.08
192 0.07
193 0.07
194 0.07
195 0.11
196 0.12
197 0.1
198 0.13
199 0.13
200 0.14
201 0.15
202 0.15
203 0.13
204 0.13
205 0.13
206 0.12
207 0.12
208 0.13
209 0.14
210 0.14
211 0.12
212 0.11
213 0.1
214 0.08
215 0.08
216 0.05
217 0.05
218 0.06
219 0.07
220 0.08
221 0.08
222 0.09
223 0.1
224 0.13
225 0.15
226 0.21
227 0.3
228 0.4
229 0.5
230 0.59
231 0.67
232 0.73
233 0.82
234 0.85
235 0.86
236 0.84
237 0.84
238 0.82
239 0.76
240 0.73
241 0.66
242 0.63
243 0.54
244 0.47
245 0.38
246 0.36
247 0.35
248 0.32
249 0.33
250 0.31
251 0.31
252 0.3
253 0.3
254 0.25
255 0.24
256 0.23
257 0.19
258 0.16
259 0.14
260 0.13
261 0.12
262 0.12
263 0.11
264 0.09
265 0.07
266 0.07
267 0.07
268 0.07
269 0.09
270 0.1
271 0.13
272 0.14
273 0.15
274 0.15
275 0.18
276 0.2
277 0.17
278 0.2
279 0.2
280 0.25
281 0.28
282 0.31
283 0.31
284 0.35
285 0.37
286 0.35
287 0.38
288 0.4
289 0.39
290 0.41
291 0.43
292 0.4
293 0.39
294 0.35
295 0.34
296 0.3
297 0.3
298 0.27
299 0.27
300 0.31
301 0.37
302 0.45
303 0.45
304 0.42
305 0.41
306 0.41
307 0.39
308 0.32
309 0.27
310 0.2
311 0.18
312 0.19
313 0.18
314 0.18
315 0.16
316 0.17
317 0.15
318 0.13
319 0.11
320 0.1
321 0.1
322 0.08
323 0.1
324 0.1
325 0.11
326 0.13
327 0.15
328 0.15
329 0.13
330 0.12
331 0.11
332 0.09
333 0.09
334 0.08
335 0.06
336 0.06
337 0.06
338 0.06
339 0.07
340 0.06
341 0.06
342 0.06
343 0.06
344 0.14
345 0.23
346 0.27
347 0.33
348 0.42
349 0.51
350 0.59
351 0.65
352 0.65
353 0.67
354 0.71
355 0.74
356 0.68
357 0.66
358 0.61
359 0.54
360 0.48
361 0.37
362 0.3
363 0.2
364 0.16
365 0.1
366 0.07
367 0.06
368 0.06
369 0.05
370 0.05
371 0.04
372 0.04
373 0.04
374 0.03
375 0.03
376 0.03
377 0.03
378 0.04
379 0.04
380 0.04
381 0.04
382 0.04
383 0.05
384 0.05
385 0.05
386 0.04
387 0.05
388 0.06
389 0.08
390 0.08
391 0.11
392 0.13
393 0.16
394 0.19
395 0.21
396 0.21
397 0.25
398 0.34
399 0.41
400 0.42
401 0.41
402 0.42
403 0.4
404 0.39
405 0.38