Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3QT42

Protein Details
Accession A0A5C3QT42    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
15-34HYVTTRKVNKRDCRDRYCTHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, nucl 8.5, cyto_nucl 7.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MCNLDTEGTKFGCGHYVTTRKVNKRDCRDRYCTHSSRHTQPCDCSHCERYLGPDCSETITHTTTDLCKNCVGYYGTGAHPWR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.24
3 0.3
4 0.32
5 0.4
6 0.48
7 0.5
8 0.58
9 0.65
10 0.67
11 0.71
12 0.79
13 0.8
14 0.8
15 0.8
16 0.76
17 0.74
18 0.74
19 0.67
20 0.61
21 0.6
22 0.57
23 0.59
24 0.62
25 0.59
26 0.52
27 0.51
28 0.53
29 0.5
30 0.49
31 0.45
32 0.4
33 0.36
34 0.35
35 0.32
36 0.32
37 0.35
38 0.34
39 0.29
40 0.27
41 0.26
42 0.27
43 0.27
44 0.22
45 0.17
46 0.15
47 0.14
48 0.14
49 0.15
50 0.16
51 0.24
52 0.24
53 0.22
54 0.23
55 0.24
56 0.24
57 0.27
58 0.26
59 0.19
60 0.21
61 0.23
62 0.23