Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3QFJ2

Protein Details
Accession A0A5C3QFJ2   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
76-116EYQPSQRVRKRRHGFLARKRTPSGRKVIAKRREKKRHFLTHBasic
NLS Segment(s)
PositionSequence
82-112RVRKRRHGFLARKRTPSGRKVIAKRREKKRH
Subcellular Location(s) mito 20, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPRIPTALARLLARPPSLPNVCSKPLSALTSSFQRSLLPRVTPSIPSLLFRHIPQPSILAGFLPQVQLRFAQRGMEYQPSQRVRKRRHGFLARKRTPSGRKVIAKRREKKRHFLTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.31
4 0.32
5 0.31
6 0.32
7 0.35
8 0.37
9 0.37
10 0.35
11 0.3
12 0.31
13 0.33
14 0.28
15 0.24
16 0.23
17 0.27
18 0.29
19 0.25
20 0.22
21 0.21
22 0.22
23 0.25
24 0.26
25 0.21
26 0.2
27 0.23
28 0.24
29 0.24
30 0.23
31 0.22
32 0.19
33 0.19
34 0.19
35 0.19
36 0.19
37 0.18
38 0.23
39 0.2
40 0.2
41 0.18
42 0.18
43 0.15
44 0.15
45 0.14
46 0.08
47 0.08
48 0.07
49 0.07
50 0.07
51 0.07
52 0.06
53 0.07
54 0.09
55 0.1
56 0.11
57 0.11
58 0.13
59 0.12
60 0.14
61 0.17
62 0.22
63 0.22
64 0.23
65 0.31
66 0.34
67 0.4
68 0.43
69 0.5
70 0.52
71 0.62
72 0.67
73 0.67
74 0.72
75 0.77
76 0.82
77 0.84
78 0.87
79 0.84
80 0.82
81 0.77
82 0.75
83 0.72
84 0.69
85 0.67
86 0.65
87 0.67
88 0.71
89 0.78
90 0.79
91 0.82
92 0.85
93 0.87
94 0.89
95 0.87
96 0.88