Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6U7S8

Protein Details
Accession Q6U7S8    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
33-84ASYSAVRSKEKKKHKKDKSKHPTFLLFILRCRKERERRKGKKKEASLNHSYNHydrophilic
NLS Segment(s)
PositionSequence
39-54RSKEKKKHKKDKSKHP
62-76RCRKERERRKGKKKE
Subcellular Location(s) mito 17, nucl 8
Family & Domain DBs
Gene Ontology GO:0005739  C:mitochondrion  
Amino Acid Sequences MLLKKKNRCNEAMHLLLLRSSFPCISSCCTNSASYSAVRSKEKKKHKKDKSKHPTFLLFILRCRKERERRKGKKKEASLNHSYNKSAAPLCSRVRIRARQINFRLIKIKNRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.4
3 0.36
4 0.3
5 0.22
6 0.15
7 0.14
8 0.12
9 0.12
10 0.13
11 0.14
12 0.19
13 0.23
14 0.23
15 0.24
16 0.25
17 0.25
18 0.24
19 0.24
20 0.21
21 0.17
22 0.2
23 0.2
24 0.22
25 0.26
26 0.31
27 0.38
28 0.45
29 0.56
30 0.63
31 0.7
32 0.77
33 0.84
34 0.89
35 0.9
36 0.93
37 0.93
38 0.93
39 0.87
40 0.8
41 0.73
42 0.63
43 0.57
44 0.52
45 0.41
46 0.35
47 0.37
48 0.36
49 0.34
50 0.38
51 0.43
52 0.47
53 0.57
54 0.64
55 0.68
56 0.76
57 0.86
58 0.91
59 0.93
60 0.92
61 0.9
62 0.89
63 0.87
64 0.84
65 0.82
66 0.78
67 0.73
68 0.65
69 0.57
70 0.48
71 0.39
72 0.34
73 0.26
74 0.21
75 0.21
76 0.25
77 0.27
78 0.34
79 0.35
80 0.4
81 0.47
82 0.53
83 0.57
84 0.6
85 0.64
86 0.67
87 0.7
88 0.73
89 0.67
90 0.64
91 0.63
92 0.58