Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3QB78

Protein Details
Accession A0A5C3QB78   
Localization Confidence High
Confidence Score 18.6
NoLS Segment(s)
PositionSequenceProtein Nature
38-101GGRDRPSRNRRVERGNCRRRFRSTGHHRLRRRAHRHLRSKIRRYRAQTKKKRRRERSSGCKAYSBasic
110-150TLCKNCERPRIHLRRRRQRLPSRHCSTHRCRGGKRRPGMLABasic
NLS Segment(s)
PositionSequence
37-93LGGRDRPSRNRRVERGNCRRRFRSTGHHRLRRRAHRHLRSKIRRYRAQTKKKRRRER
122-130LRRRRQRLP
143-144KR
Subcellular Location(s) nucl 15.5, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MEILRVHTRTRCYSIHCCCYSTPAPYPSTQPLWKQRLGGRDRPSRNRRVERGNCRRRFRSTGHHRLRRRAHRHLRSKIRRYRAQTKKKRRRERSSGCKAYSSHCTNSGCTLCKNCERPRIHLRRRRQRLPSRHCSTHRCRGGKRRPGMLARAMESRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.62
3 0.58
4 0.54
5 0.49
6 0.53
7 0.49
8 0.45
9 0.42
10 0.38
11 0.38
12 0.37
13 0.41
14 0.39
15 0.42
16 0.4
17 0.41
18 0.47
19 0.5
20 0.51
21 0.51
22 0.5
23 0.53
24 0.55
25 0.56
26 0.55
27 0.59
28 0.65
29 0.7
30 0.75
31 0.74
32 0.78
33 0.78
34 0.76
35 0.77
36 0.79
37 0.8
38 0.83
39 0.85
40 0.83
41 0.82
42 0.81
43 0.77
44 0.72
45 0.66
46 0.65
47 0.65
48 0.68
49 0.71
50 0.75
51 0.72
52 0.76
53 0.81
54 0.8
55 0.78
56 0.77
57 0.78
58 0.79
59 0.85
60 0.85
61 0.87
62 0.86
63 0.88
64 0.84
65 0.82
66 0.79
67 0.76
68 0.78
69 0.77
70 0.78
71 0.79
72 0.83
73 0.85
74 0.9
75 0.93
76 0.93
77 0.92
78 0.92
79 0.92
80 0.92
81 0.92
82 0.89
83 0.8
84 0.73
85 0.64
86 0.56
87 0.53
88 0.47
89 0.38
90 0.35
91 0.35
92 0.32
93 0.36
94 0.36
95 0.3
96 0.27
97 0.29
98 0.28
99 0.34
100 0.41
101 0.41
102 0.48
103 0.49
104 0.55
105 0.63
106 0.7
107 0.73
108 0.74
109 0.79
110 0.81
111 0.88
112 0.89
113 0.89
114 0.88
115 0.89
116 0.9
117 0.9
118 0.87
119 0.87
120 0.84
121 0.83
122 0.81
123 0.8
124 0.8
125 0.77
126 0.77
127 0.79
128 0.83
129 0.83
130 0.82
131 0.8
132 0.79
133 0.77
134 0.74
135 0.71
136 0.65
137 0.58