Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3QLK7

Protein Details
Accession A0A5C3QLK7    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
108-131STRTNPHPHQSRIRKRPHLLRAARHydrophilic
NLS Segment(s)
PositionSequence
118-146SRIRKRPHLLRAARARLRDGRHPRRFREG
Subcellular Location(s) nucl 10, cyto_nucl 9, mito 7, cyto 6, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007304  TAP46-like  
Gene Ontology GO:0009966  P:regulation of signal transduction  
Pfam View protein in Pfam  
PF04177  TAP42  
Amino Acid Sequences MWKLDKADPKTGPLMDEAGRPLRPFTILPSGTTAADRARLKAQVFGPDHSLPTMTIDEYLEIEQERGNIITGGGYVSIFVVLPPLGFCPPSVLSSHSLLSQSCSLPPSTRTNPHPHQSRIRKRPHLLRAARARLRDGRHPRRFREGGAEEAKGGEVGSVYG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.24
3 0.25
4 0.24
5 0.23
6 0.24
7 0.23
8 0.22
9 0.2
10 0.21
11 0.19
12 0.2
13 0.26
14 0.25
15 0.26
16 0.29
17 0.29
18 0.28
19 0.28
20 0.24
21 0.15
22 0.21
23 0.21
24 0.19
25 0.2
26 0.24
27 0.24
28 0.29
29 0.3
30 0.32
31 0.33
32 0.32
33 0.34
34 0.31
35 0.31
36 0.25
37 0.24
38 0.15
39 0.16
40 0.15
41 0.1
42 0.09
43 0.09
44 0.09
45 0.1
46 0.09
47 0.07
48 0.07
49 0.07
50 0.06
51 0.06
52 0.07
53 0.06
54 0.06
55 0.05
56 0.05
57 0.05
58 0.05
59 0.04
60 0.04
61 0.04
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.04
72 0.05
73 0.05
74 0.05
75 0.08
76 0.09
77 0.1
78 0.11
79 0.12
80 0.14
81 0.16
82 0.16
83 0.14
84 0.14
85 0.13
86 0.15
87 0.14
88 0.12
89 0.12
90 0.12
91 0.12
92 0.13
93 0.16
94 0.22
95 0.25
96 0.31
97 0.35
98 0.43
99 0.49
100 0.56
101 0.6
102 0.58
103 0.64
104 0.69
105 0.75
106 0.76
107 0.8
108 0.81
109 0.81
110 0.85
111 0.84
112 0.83
113 0.78
114 0.78
115 0.77
116 0.78
117 0.75
118 0.67
119 0.63
120 0.6
121 0.59
122 0.6
123 0.61
124 0.62
125 0.68
126 0.75
127 0.74
128 0.78
129 0.75
130 0.67
131 0.67
132 0.59
133 0.57
134 0.54
135 0.49
136 0.39
137 0.37
138 0.34
139 0.24
140 0.2
141 0.11