Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2M234

Protein Details
Accession E2M234   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MPLLTRNFPHKRQNTRSQSTYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 9.5, mito 7, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007991  RNA_pol_I_trans_ini_fac_RRN3  
Gene Ontology GO:0001181  F:RNA polymerase I general transcription initiation factor activity  
GO:0006361  P:transcription initiation at RNA polymerase I promoter  
KEGG mpr:MPER_13990  -  
Pfam View protein in Pfam  
PF05327  RRN3  
Amino Acid Sequences MPLLTRNFPHKRQNTRSQSTYIKNLLRVSAYCPELSDGILELVIDRAIQIDVQIQVEIDDIEDDIGDSDNDNSNNPPSSSAEIFDIDLDTVVGQEPSDTSDSDSDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.81
3 0.78
4 0.73
5 0.72
6 0.66
7 0.64
8 0.6
9 0.53
10 0.49
11 0.46
12 0.42
13 0.36
14 0.31
15 0.28
16 0.27
17 0.25
18 0.21
19 0.2
20 0.2
21 0.18
22 0.17
23 0.13
24 0.08
25 0.07
26 0.07
27 0.06
28 0.05
29 0.04
30 0.04
31 0.04
32 0.03
33 0.03
34 0.04
35 0.04
36 0.04
37 0.05
38 0.06
39 0.06
40 0.06
41 0.05
42 0.06
43 0.06
44 0.06
45 0.04
46 0.04
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.04
53 0.03
54 0.04
55 0.05
56 0.08
57 0.08
58 0.09
59 0.1
60 0.12
61 0.14
62 0.14
63 0.15
64 0.15
65 0.19
66 0.19
67 0.19
68 0.19
69 0.18
70 0.18
71 0.16
72 0.14
73 0.1
74 0.09
75 0.08
76 0.06
77 0.05
78 0.06
79 0.05
80 0.04
81 0.05
82 0.05
83 0.08
84 0.1
85 0.1
86 0.12