Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3Q7N4

Protein Details
Accession A0A5C3Q7N4    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
4-25AVRGAIRRWRWREERRIHIKRGBasic
NLS Segment(s)
PositionSequence
10-25RRWRWREERRIHIKRG
Subcellular Location(s) mito 17, nucl 5, cyto 4
Family & Domain DBs
Amino Acid Sequences MLSAVRGAIRRWRWREERRIHIKRGGSRYERIGLCDFWYWLCQDSNFQLRFSAFAVWIEVEVESNGFPGDCQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.78
3 0.78
4 0.8
5 0.82
6 0.84
7 0.8
8 0.76
9 0.73
10 0.7
11 0.68
12 0.65
13 0.58
14 0.53
15 0.51
16 0.51
17 0.45
18 0.4
19 0.35
20 0.27
21 0.25
22 0.23
23 0.19
24 0.13
25 0.13
26 0.11
27 0.1
28 0.1
29 0.09
30 0.1
31 0.13
32 0.21
33 0.21
34 0.21
35 0.21
36 0.2
37 0.21
38 0.2
39 0.19
40 0.11
41 0.11
42 0.12
43 0.1
44 0.1
45 0.1
46 0.09
47 0.08
48 0.07
49 0.07
50 0.06
51 0.06
52 0.06
53 0.06