Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5C3Q475

Protein Details
Accession A0A5C3Q475   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
8-36PPSATPAPAPRRKRCPPGKRRSQGYIPRPHydrophilic
NLS Segment(s)
PositionSequence
17-28PRRKRCPPGKRR
Subcellular Location(s) mito 17, cyto 4.5, cyto_nucl 4.5, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01389  HMG-box_ROX1-like  
Amino Acid Sequences MDGATLFPPSATPAPAPRRKRCPPGKRRSQGYIPRPPNAFMLFRADFVRQKHVPGSIETNHGSLSKIIGNCWRSLPPNEKRVWEQRAKTAKAEHKIAHPDYRFRPVHNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.43
3 0.51
4 0.56
5 0.64
6 0.71
7 0.79
8 0.82
9 0.83
10 0.85
11 0.87
12 0.9
13 0.89
14 0.88
15 0.84
16 0.83
17 0.82
18 0.8
19 0.79
20 0.73
21 0.69
22 0.63
23 0.57
24 0.5
25 0.43
26 0.35
27 0.25
28 0.27
29 0.23
30 0.22
31 0.23
32 0.22
33 0.22
34 0.23
35 0.29
36 0.22
37 0.23
38 0.23
39 0.24
40 0.23
41 0.21
42 0.24
43 0.18
44 0.21
45 0.2
46 0.19
47 0.17
48 0.16
49 0.16
50 0.11
51 0.11
52 0.11
53 0.1
54 0.11
55 0.17
56 0.18
57 0.18
58 0.2
59 0.21
60 0.21
61 0.26
62 0.34
63 0.35
64 0.42
65 0.44
66 0.45
67 0.49
68 0.54
69 0.57
70 0.57
71 0.53
72 0.55
73 0.62
74 0.61
75 0.59
76 0.6
77 0.59
78 0.58
79 0.61
80 0.53
81 0.51
82 0.57
83 0.57
84 0.57
85 0.53
86 0.55
87 0.53
88 0.61
89 0.55