Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5C3R0Z8

Protein Details
Accession A0A5C3R0Z8    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-27SAPPLSSSSRSRPQQRKKQTDDAAYIHydrophilic
NLS Segment(s)
PositionSequence
47-51RQKRK
143-155RPRRDGGKEGRRR
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MSAPPLSSSSRSRPQQRKKQTDDAAYIGASATGVKRQAPERADGEPRQKRKKLEPIFAVAASSSRRADSSNESKAESDKAAALSFMTLPVETLYAYLSQHDIIPGIYPAPNSVQDPPPPSSFEDPVQQSFITGGGHAGAPVNRPRRDGGKEGRRRSLRLQEDDFATRPPILADLRELHAVMARLVEKHLTTQSNSTREVDTLAGFMCSVDKRRNLDRLHVGSMYPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.81
3 0.86
4 0.89
5 0.88
6 0.9
7 0.88
8 0.84
9 0.78
10 0.7
11 0.6
12 0.49
13 0.41
14 0.3
15 0.22
16 0.14
17 0.1
18 0.08
19 0.09
20 0.1
21 0.11
22 0.15
23 0.18
24 0.24
25 0.26
26 0.3
27 0.3
28 0.34
29 0.39
30 0.41
31 0.49
32 0.51
33 0.59
34 0.64
35 0.66
36 0.67
37 0.7
38 0.75
39 0.74
40 0.74
41 0.69
42 0.65
43 0.63
44 0.57
45 0.48
46 0.37
47 0.3
48 0.22
49 0.2
50 0.14
51 0.11
52 0.11
53 0.12
54 0.15
55 0.22
56 0.28
57 0.32
58 0.33
59 0.33
60 0.34
61 0.34
62 0.33
63 0.25
64 0.18
65 0.13
66 0.12
67 0.11
68 0.11
69 0.09
70 0.08
71 0.07
72 0.07
73 0.06
74 0.05
75 0.05
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.05
82 0.05
83 0.06
84 0.06
85 0.06
86 0.06
87 0.06
88 0.06
89 0.05
90 0.06
91 0.05
92 0.05
93 0.06
94 0.05
95 0.06
96 0.07
97 0.08
98 0.09
99 0.11
100 0.13
101 0.14
102 0.18
103 0.2
104 0.2
105 0.21
106 0.22
107 0.22
108 0.21
109 0.21
110 0.22
111 0.21
112 0.21
113 0.21
114 0.18
115 0.16
116 0.14
117 0.13
118 0.09
119 0.07
120 0.06
121 0.05
122 0.05
123 0.05
124 0.05
125 0.05
126 0.08
127 0.14
128 0.22
129 0.22
130 0.24
131 0.26
132 0.31
133 0.35
134 0.4
135 0.44
136 0.48
137 0.56
138 0.6
139 0.67
140 0.64
141 0.64
142 0.63
143 0.63
144 0.6
145 0.57
146 0.56
147 0.5
148 0.5
149 0.5
150 0.44
151 0.35
152 0.28
153 0.21
154 0.17
155 0.15
156 0.14
157 0.12
158 0.12
159 0.14
160 0.15
161 0.17
162 0.18
163 0.18
164 0.15
165 0.16
166 0.16
167 0.13
168 0.13
169 0.12
170 0.11
171 0.12
172 0.14
173 0.12
174 0.14
175 0.19
176 0.19
177 0.2
178 0.27
179 0.34
180 0.36
181 0.38
182 0.38
183 0.34
184 0.32
185 0.32
186 0.26
187 0.19
188 0.16
189 0.14
190 0.12
191 0.1
192 0.1
193 0.11
194 0.12
195 0.16
196 0.21
197 0.27
198 0.32
199 0.4
200 0.48
201 0.48
202 0.55
203 0.61
204 0.6
205 0.59
206 0.54