Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4C2E0B1

Protein Details
Accession A0A4C2E0B1   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
35-67GSQWSQSKKRRVVKIKKPQKKLKGSPNAKREYSHydrophilic
NLS Segment(s)
PositionSequence
41-63SKKRRVVKIKKPQKKLKGSPNAK
Subcellular Location(s) nucl 15.5, mito_nucl 13.333, cyto_nucl 9.666, mito 9
Family & Domain DBs
Amino Acid Sequences MSESNGKLSSRVMNMKFMRQTFQQSVEPPKPVRDGSQWSQSKKRRVVKIKKPQKKLKGSPNAKREYSNDQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.45
3 0.48
4 0.44
5 0.42
6 0.37
7 0.42
8 0.36
9 0.38
10 0.35
11 0.33
12 0.4
13 0.39
14 0.41
15 0.35
16 0.34
17 0.32
18 0.29
19 0.29
20 0.25
21 0.28
22 0.28
23 0.37
24 0.39
25 0.4
26 0.48
27 0.52
28 0.57
29 0.59
30 0.64
31 0.64
32 0.7
33 0.78
34 0.8
35 0.84
36 0.87
37 0.88
38 0.9
39 0.91
40 0.9
41 0.9
42 0.88
43 0.88
44 0.88
45 0.89
46 0.88
47 0.88
48 0.85
49 0.77
50 0.72