Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1NCA6

Protein Details
Accession A0A4Z1NCA6    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
51-70AVLGPRQRRTPPRAWKRRMQHydrophilic
NLS Segment(s)
PositionSequence
52-69VLGPRQRRTPPRAWKRRM
Subcellular Location(s) mito 22, nucl 3.5, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MGRDFRSLLPRNPHKCLKKYAFTFSFKSVRVSHQLAQAHTDLKTVKKARDAVLGPRQRRTPPRAWKRRMQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.7
3 0.73
4 0.7
5 0.69
6 0.67
7 0.69
8 0.66
9 0.62
10 0.6
11 0.55
12 0.52
13 0.43
14 0.43
15 0.35
16 0.32
17 0.33
18 0.33
19 0.3
20 0.31
21 0.32
22 0.28
23 0.29
24 0.27
25 0.22
26 0.19
27 0.18
28 0.14
29 0.13
30 0.21
31 0.22
32 0.23
33 0.28
34 0.31
35 0.32
36 0.38
37 0.39
38 0.4
39 0.47
40 0.53
41 0.5
42 0.52
43 0.54
44 0.54
45 0.6
46 0.6
47 0.6
48 0.63
49 0.72
50 0.77