Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1PG45

Protein Details
Accession A0A4Z1PG45    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
71-100EGEKNEKETRKTRKTRKTRDRRRIQMLEIMBasic
NLS Segment(s)
PositionSequence
76-93EKETRKTRKTRKTRDRRR
Subcellular Location(s) nucl 17.5, cyto_nucl 11.833, cyto 5, cyto_pero 3.333
Family & Domain DBs
Amino Acid Sequences MVEFTNGQGKNEMTGDLSYCQASEINEVRKNDGDDGTDVDRDGHNKNDEGEENVEDTDADNEDKDKDGEGEGEKNEKETRKTRKTRKTRDRRRIQMLEIMTRTAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.14
4 0.15
5 0.12
6 0.12
7 0.12
8 0.11
9 0.11
10 0.14
11 0.18
12 0.24
13 0.28
14 0.29
15 0.31
16 0.33
17 0.34
18 0.3
19 0.26
20 0.21
21 0.17
22 0.19
23 0.18
24 0.16
25 0.15
26 0.13
27 0.13
28 0.14
29 0.14
30 0.15
31 0.15
32 0.15
33 0.16
34 0.17
35 0.17
36 0.17
37 0.17
38 0.14
39 0.13
40 0.12
41 0.11
42 0.09
43 0.08
44 0.07
45 0.06
46 0.05
47 0.05
48 0.06
49 0.06
50 0.07
51 0.07
52 0.07
53 0.07
54 0.07
55 0.09
56 0.11
57 0.13
58 0.13
59 0.16
60 0.16
61 0.18
62 0.21
63 0.23
64 0.27
65 0.33
66 0.42
67 0.5
68 0.6
69 0.69
70 0.76
71 0.84
72 0.9
73 0.92
74 0.93
75 0.94
76 0.95
77 0.95
78 0.95
79 0.94
80 0.89
81 0.82
82 0.79
83 0.72
84 0.7
85 0.6