Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1PV85

Protein Details
Accession A0A4Z1PV85    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
19-46DAVSARIKKNKKTQKIKFKVRCKRHLYTHydrophilic
NLS Segment(s)
PositionSequence
23-38ARIKKNKKTQKIKFKV
74-80KNAKGKR
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPAEVTDIKQFIEICRRKDAVSARIKKNKKTQKIKFKVRCKRHLYTLVLKDSDRAEKLKQSLPPGLSISDTPKKNAKGKRTAKTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.38
3 0.39
4 0.37
5 0.42
6 0.45
7 0.44
8 0.49
9 0.55
10 0.57
11 0.66
12 0.7
13 0.71
14 0.75
15 0.76
16 0.76
17 0.78
18 0.79
19 0.81
20 0.87
21 0.9
22 0.9
23 0.9
24 0.9
25 0.88
26 0.88
27 0.84
28 0.78
29 0.74
30 0.72
31 0.66
32 0.65
33 0.61
34 0.55
35 0.49
36 0.45
37 0.39
38 0.33
39 0.31
40 0.24
41 0.2
42 0.18
43 0.22
44 0.26
45 0.29
46 0.31
47 0.32
48 0.35
49 0.34
50 0.35
51 0.32
52 0.29
53 0.25
54 0.23
55 0.26
56 0.28
57 0.29
58 0.29
59 0.35
60 0.41
61 0.48
62 0.55
63 0.57
64 0.6
65 0.69