Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1PBU5

Protein Details
Accession A0A4Z1PBU5    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MFEAITKYFRRRKKPSYSSLASMHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021986  Spherulin4  
Pfam View protein in Pfam  
PF12138  Spherulin4  
Amino Acid Sequences MFEAITKYFRRRKKPSYSSLASMDDPKMTPRSTVLFPLYIYPHPGAWEPLYEAITSHPELKFVLVVNPHNGPGVFPLTDSNYIREIARLNSIQNVCTVGYVKVDYCKRDIAEVHRDIEVFSQWSKDYATTGLGVHGIFLDEAPNEHSDHVGPYLENTASKIKGSEGILGDRIIIHNPGTTVDAKLTDADPGPDITAVVEESFEQYRSNSMQERLLLNRLDRTKCSYIVHTVPKAELKPLVHQLRTRGEYLFVTDLCADYYSQFGPSWSEFIEAMVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.85
3 0.86
4 0.84
5 0.79
6 0.74
7 0.67
8 0.58
9 0.52
10 0.43
11 0.35
12 0.3
13 0.28
14 0.27
15 0.24
16 0.23
17 0.22
18 0.25
19 0.24
20 0.29
21 0.28
22 0.26
23 0.26
24 0.28
25 0.29
26 0.26
27 0.27
28 0.23
29 0.2
30 0.2
31 0.21
32 0.2
33 0.17
34 0.18
35 0.16
36 0.18
37 0.18
38 0.16
39 0.15
40 0.14
41 0.17
42 0.16
43 0.18
44 0.16
45 0.16
46 0.16
47 0.17
48 0.16
49 0.13
50 0.16
51 0.16
52 0.18
53 0.2
54 0.21
55 0.2
56 0.2
57 0.19
58 0.16
59 0.14
60 0.15
61 0.12
62 0.11
63 0.12
64 0.14
65 0.19
66 0.2
67 0.19
68 0.18
69 0.19
70 0.19
71 0.18
72 0.17
73 0.14
74 0.17
75 0.16
76 0.15
77 0.21
78 0.22
79 0.21
80 0.19
81 0.19
82 0.15
83 0.15
84 0.15
85 0.09
86 0.1
87 0.1
88 0.1
89 0.15
90 0.17
91 0.18
92 0.19
93 0.21
94 0.2
95 0.22
96 0.24
97 0.24
98 0.3
99 0.31
100 0.3
101 0.28
102 0.28
103 0.26
104 0.24
105 0.19
106 0.11
107 0.09
108 0.09
109 0.08
110 0.09
111 0.09
112 0.09
113 0.09
114 0.08
115 0.09
116 0.08
117 0.08
118 0.08
119 0.08
120 0.07
121 0.07
122 0.06
123 0.05
124 0.04
125 0.04
126 0.04
127 0.03
128 0.04
129 0.05
130 0.06
131 0.07
132 0.07
133 0.07
134 0.07
135 0.08
136 0.08
137 0.07
138 0.06
139 0.06
140 0.08
141 0.08
142 0.08
143 0.09
144 0.11
145 0.11
146 0.11
147 0.11
148 0.09
149 0.13
150 0.14
151 0.16
152 0.15
153 0.15
154 0.16
155 0.16
156 0.15
157 0.12
158 0.12
159 0.08
160 0.08
161 0.07
162 0.07
163 0.07
164 0.08
165 0.09
166 0.1
167 0.1
168 0.1
169 0.1
170 0.1
171 0.11
172 0.1
173 0.1
174 0.09
175 0.09
176 0.1
177 0.09
178 0.09
179 0.08
180 0.08
181 0.06
182 0.07
183 0.06
184 0.05
185 0.05
186 0.05
187 0.07
188 0.08
189 0.08
190 0.08
191 0.08
192 0.11
193 0.13
194 0.16
195 0.17
196 0.19
197 0.21
198 0.24
199 0.27
200 0.27
201 0.3
202 0.28
203 0.26
204 0.31
205 0.34
206 0.35
207 0.34
208 0.39
209 0.38
210 0.39
211 0.41
212 0.37
213 0.37
214 0.41
215 0.47
216 0.43
217 0.4
218 0.4
219 0.41
220 0.39
221 0.35
222 0.33
223 0.27
224 0.3
225 0.39
226 0.43
227 0.42
228 0.44
229 0.48
230 0.52
231 0.53
232 0.48
233 0.39
234 0.35
235 0.32
236 0.33
237 0.31
238 0.22
239 0.21
240 0.2
241 0.19
242 0.18
243 0.17
244 0.14
245 0.1
246 0.13
247 0.11
248 0.13
249 0.13
250 0.12
251 0.16
252 0.17
253 0.19
254 0.17
255 0.18
256 0.16