Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1PDR6

Protein Details
Accession A0A4Z1PDR6    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
323-365YDDHSRDDRDKEKRRDRERDHGRIRDRDERKHKSSRRERSASVBasic
375-435DSEDAHRIRKRKDKERRHRDRSSSPESRHRSRYGDKPQRDTKSRDEPRSHHKDRSDRDRRRBasic
NLS Segment(s)
PositionSequence
332-435DKEKRRDRERDHGRIRDRDERKHKSSRRERSASVDSHRRRKDDDSEDAHRIRKRKDKERRHRDRSSSPESRHRSRYGDKPQRDTKSRDEPRSHHKDRSDRDRRR
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000467  G_patch_dom  
IPR045166  Spp2-like  
IPR026822  Spp2/MOS2_G-patch  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0003676  F:nucleic acid binding  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF12656  G-patch_2  
PROSITE View protein in PROSITE  
PS50174  G_PATCH  
Amino Acid Sequences MVEPKKITLSLGAKKKPQSLSTPLNGTKRPHSALHDSDNEDDAEGKHEEVTHFDLSAGGAVHTDKKVAPKQLLVIPLSEHSKKRQRSGLPTQDTEAAEAAVAEAKAKAAPIQFGLNVGSRSAEDVEVAPKNEPPTEQVGFKKRTVEEEALDSLLGKGPSSNAVIPALTDQETFERDYDEAPDVPTEADYDAVPIEEFGAAMLRGMGWKDGDAIGKKRGQKPVVQRVIERRADLLGVGAKPAKALGIELGEWGKHANKHERAINKAYAPVVLKNKKTGELVTEEELKAKLKEQEEQAFVMVEEDLKTERRLEYRSSKSSRRDEYDDHSRDDRDKEKRRDRERDHGRIRDRDERKHKSSRRERSASVDSHRRRKDDDSEDAHRIRKRKDKERRHRDRSSSPESRHRSRYGDKPQRDTKSRDEPRSHHKDRSDRDRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.68
3 0.65
4 0.62
5 0.61
6 0.6
7 0.62
8 0.62
9 0.65
10 0.63
11 0.64
12 0.64
13 0.61
14 0.59
15 0.57
16 0.55
17 0.5
18 0.51
19 0.52
20 0.54
21 0.57
22 0.56
23 0.52
24 0.5
25 0.47
26 0.41
27 0.33
28 0.28
29 0.21
30 0.18
31 0.15
32 0.14
33 0.13
34 0.15
35 0.15
36 0.17
37 0.21
38 0.18
39 0.18
40 0.17
41 0.17
42 0.15
43 0.16
44 0.13
45 0.08
46 0.08
47 0.09
48 0.12
49 0.12
50 0.13
51 0.14
52 0.21
53 0.27
54 0.32
55 0.34
56 0.33
57 0.38
58 0.41
59 0.44
60 0.37
61 0.32
62 0.27
63 0.28
64 0.31
65 0.3
66 0.29
67 0.32
68 0.41
69 0.45
70 0.5
71 0.56
72 0.58
73 0.63
74 0.72
75 0.74
76 0.71
77 0.68
78 0.63
79 0.6
80 0.53
81 0.44
82 0.33
83 0.23
84 0.15
85 0.13
86 0.11
87 0.07
88 0.07
89 0.06
90 0.06
91 0.06
92 0.07
93 0.07
94 0.09
95 0.08
96 0.1
97 0.11
98 0.13
99 0.12
100 0.13
101 0.15
102 0.15
103 0.14
104 0.13
105 0.12
106 0.1
107 0.12
108 0.12
109 0.1
110 0.08
111 0.09
112 0.13
113 0.14
114 0.15
115 0.14
116 0.15
117 0.17
118 0.17
119 0.17
120 0.16
121 0.19
122 0.2
123 0.24
124 0.28
125 0.35
126 0.38
127 0.39
128 0.42
129 0.37
130 0.4
131 0.41
132 0.38
133 0.31
134 0.3
135 0.3
136 0.24
137 0.23
138 0.18
139 0.13
140 0.13
141 0.11
142 0.08
143 0.07
144 0.07
145 0.09
146 0.11
147 0.11
148 0.09
149 0.1
150 0.1
151 0.1
152 0.1
153 0.1
154 0.08
155 0.08
156 0.08
157 0.08
158 0.1
159 0.11
160 0.1
161 0.1
162 0.1
163 0.1
164 0.12
165 0.12
166 0.11
167 0.11
168 0.11
169 0.1
170 0.09
171 0.09
172 0.08
173 0.06
174 0.06
175 0.05
176 0.06
177 0.05
178 0.05
179 0.05
180 0.04
181 0.04
182 0.04
183 0.04
184 0.03
185 0.04
186 0.03
187 0.03
188 0.03
189 0.03
190 0.03
191 0.04
192 0.04
193 0.04
194 0.04
195 0.05
196 0.06
197 0.08
198 0.1
199 0.13
200 0.16
201 0.2
202 0.25
203 0.3
204 0.35
205 0.35
206 0.38
207 0.46
208 0.53
209 0.57
210 0.53
211 0.5
212 0.52
213 0.58
214 0.53
215 0.44
216 0.34
217 0.26
218 0.25
219 0.22
220 0.15
221 0.1
222 0.08
223 0.09
224 0.09
225 0.08
226 0.08
227 0.08
228 0.07
229 0.05
230 0.05
231 0.05
232 0.05
233 0.06
234 0.06
235 0.07
236 0.06
237 0.06
238 0.07
239 0.08
240 0.1
241 0.14
242 0.22
243 0.26
244 0.3
245 0.35
246 0.39
247 0.42
248 0.45
249 0.44
250 0.36
251 0.34
252 0.3
253 0.27
254 0.24
255 0.24
256 0.28
257 0.31
258 0.31
259 0.34
260 0.35
261 0.36
262 0.36
263 0.31
264 0.25
265 0.24
266 0.25
267 0.22
268 0.24
269 0.22
270 0.22
271 0.21
272 0.2
273 0.16
274 0.16
275 0.19
276 0.17
277 0.22
278 0.26
279 0.31
280 0.31
281 0.32
282 0.29
283 0.24
284 0.23
285 0.19
286 0.13
287 0.08
288 0.06
289 0.07
290 0.07
291 0.08
292 0.09
293 0.11
294 0.13
295 0.16
296 0.19
297 0.24
298 0.33
299 0.4
300 0.48
301 0.53
302 0.58
303 0.63
304 0.69
305 0.7
306 0.66
307 0.64
308 0.59
309 0.6
310 0.64
311 0.59
312 0.54
313 0.5
314 0.45
315 0.43
316 0.44
317 0.45
318 0.44
319 0.52
320 0.58
321 0.66
322 0.74
323 0.81
324 0.87
325 0.86
326 0.87
327 0.87
328 0.87
329 0.86
330 0.85
331 0.83
332 0.8
333 0.79
334 0.78
335 0.74
336 0.74
337 0.75
338 0.75
339 0.75
340 0.78
341 0.79
342 0.8
343 0.84
344 0.85
345 0.84
346 0.82
347 0.77
348 0.74
349 0.75
350 0.7
351 0.68
352 0.67
353 0.65
354 0.68
355 0.71
356 0.66
357 0.63
358 0.63
359 0.65
360 0.62
361 0.63
362 0.61
363 0.61
364 0.65
365 0.64
366 0.64
367 0.58
368 0.57
369 0.56
370 0.58
371 0.62
372 0.65
373 0.73
374 0.78
375 0.85
376 0.9
377 0.93
378 0.93
379 0.93
380 0.92
381 0.91
382 0.89
383 0.88
384 0.86
385 0.81
386 0.82
387 0.8
388 0.79
389 0.76
390 0.72
391 0.7
392 0.68
393 0.71
394 0.72
395 0.75
396 0.75
397 0.77
398 0.82
399 0.84
400 0.83
401 0.79
402 0.77
403 0.78
404 0.79
405 0.8
406 0.79
407 0.76
408 0.79
409 0.83
410 0.8
411 0.77
412 0.76
413 0.77
414 0.78
415 0.83