Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1NYT2

Protein Details
Accession A0A4Z1NYT2    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
56-79KEMEWFERKKKNIRKNPRERLMYSHydrophilic
NLS Segment(s)
PositionSequence
63-73RKKKNIRKNPR
Subcellular Location(s) nucl 21, mito 3, cyto 2
Family & Domain DBs
Amino Acid Sequences MLGGEERPVDDKQQQTAVVNTALALSAPVTEKSNKKHTRVTFASNCRNKMEDWKSKEMEWFERKKKNIRKNPRERLMYSLAHTDAVRLLDTAGTSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.29
3 0.3
4 0.28
5 0.23
6 0.19
7 0.16
8 0.12
9 0.11
10 0.08
11 0.07
12 0.04
13 0.05
14 0.06
15 0.07
16 0.09
17 0.13
18 0.18
19 0.23
20 0.34
21 0.38
22 0.41
23 0.49
24 0.49
25 0.54
26 0.54
27 0.57
28 0.54
29 0.56
30 0.62
31 0.58
32 0.57
33 0.5
34 0.47
35 0.39
36 0.4
37 0.41
38 0.4
39 0.42
40 0.46
41 0.46
42 0.46
43 0.49
44 0.42
45 0.43
46 0.42
47 0.44
48 0.46
49 0.52
50 0.56
51 0.63
52 0.7
53 0.72
54 0.75
55 0.78
56 0.81
57 0.85
58 0.92
59 0.91
60 0.88
61 0.79
62 0.75
63 0.7
64 0.62
65 0.53
66 0.46
67 0.37
68 0.32
69 0.3
70 0.24
71 0.2
72 0.18
73 0.16
74 0.11
75 0.11
76 0.1