Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1P2P6

Protein Details
Accession A0A4Z1P2P6    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
4-55PRRAEIRVRRILRKLRLRRTRIEKVAGQERRPTRRTFRRRKRIPGTNVKVTVBasic
NLS Segment(s)
PositionSequence
5-46RRAEIRVRRILRKLRLRRTRIEKVAGQERRPTRRTFRRRKRI
141-177MYRKVKGDRKVREEEKERKEPRPEVKEAKKNVKAEKK
Subcellular Location(s) nucl 14, mito 10, cyto 3
Family & Domain DBs
Amino Acid Sequences MTAPRRAEIRVRRILRKLRLRRTRIEKVAGQERRPTRRTFRRRKRIPGTNVKVTVPSTDGAAEEYYAESFAITNLNPPLPPPAMKSERHPRLTGSVEKYPIDRFGNDAAFAHNPAPAPNDPNVYHPPGSQPLSKRGTFKNMYRKVKGDRKVREEEKERKEPRPEVKEAKKNVKAEKKQAYLFAKFDKALATRATNVVKASSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.78
3 0.8
4 0.81
5 0.82
6 0.85
7 0.84
8 0.85
9 0.85
10 0.85
11 0.82
12 0.78
13 0.71
14 0.69
15 0.73
16 0.69
17 0.63
18 0.61
19 0.62
20 0.64
21 0.63
22 0.61
23 0.61
24 0.66
25 0.74
26 0.77
27 0.8
28 0.82
29 0.88
30 0.93
31 0.93
32 0.92
33 0.91
34 0.91
35 0.88
36 0.85
37 0.78
38 0.68
39 0.59
40 0.5
41 0.41
42 0.31
43 0.23
44 0.14
45 0.12
46 0.11
47 0.1
48 0.1
49 0.08
50 0.07
51 0.07
52 0.07
53 0.06
54 0.06
55 0.05
56 0.04
57 0.05
58 0.06
59 0.05
60 0.07
61 0.08
62 0.09
63 0.09
64 0.09
65 0.12
66 0.12
67 0.13
68 0.14
69 0.2
70 0.24
71 0.25
72 0.32
73 0.39
74 0.46
75 0.48
76 0.46
77 0.4
78 0.4
79 0.43
80 0.42
81 0.36
82 0.31
83 0.3
84 0.3
85 0.3
86 0.26
87 0.25
88 0.21
89 0.16
90 0.14
91 0.15
92 0.15
93 0.14
94 0.14
95 0.12
96 0.11
97 0.12
98 0.11
99 0.09
100 0.09
101 0.09
102 0.12
103 0.11
104 0.13
105 0.14
106 0.17
107 0.17
108 0.21
109 0.25
110 0.24
111 0.25
112 0.22
113 0.24
114 0.25
115 0.26
116 0.26
117 0.26
118 0.3
119 0.34
120 0.36
121 0.37
122 0.36
123 0.41
124 0.42
125 0.47
126 0.5
127 0.55
128 0.6
129 0.6
130 0.63
131 0.64
132 0.68
133 0.69
134 0.68
135 0.67
136 0.67
137 0.73
138 0.73
139 0.73
140 0.73
141 0.75
142 0.74
143 0.76
144 0.73
145 0.71
146 0.73
147 0.72
148 0.72
149 0.7
150 0.69
151 0.69
152 0.74
153 0.76
154 0.76
155 0.79
156 0.76
157 0.74
158 0.77
159 0.77
160 0.75
161 0.76
162 0.78
163 0.74
164 0.69
165 0.72
166 0.68
167 0.62
168 0.58
169 0.53
170 0.48
171 0.42
172 0.39
173 0.35
174 0.3
175 0.29
176 0.29
177 0.27
178 0.25
179 0.31
180 0.33
181 0.3
182 0.3